5XPF: T26H mutant of T4 lysozyme

High-resolution X-ray structure of the T26H mutant of T4 lysozyme. Determined by X-ray diffraction at 1.04 Å resolution. Released 4 Oct 2017.

Method: X-ray diffraction
Resolution: 1.04 Å
Organism: Enterobacteria phage T4
Chains: 1
Atoms: 2,018
Mol. weight: 19.66 kDa
Ligands: HEZ
Released: 4 Oct 2017

Explore 5XPF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5XPF contains 10 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	3-11	9
β-strand	14-15	2	1
β-strand	16	1	2
β-strand	17-19	3	1
β-strand	25-28	4	1
β-strand	31-32	2	1
α-helix	39-50	12
β-strand	57	1	2
α-helix	60-80	21
α-helix	84-90	7
α-helix	93-106	14
α-helix	108-112	5
α-helix	115-122	8
α-helix	126-133	8
α-helix	137-141	5
α-helix	143-155	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Endolysin	A	protein	164	Enterobacteria phage T4	P00720

Sequence of entity 1 (A), FASTA

>5XPF_1 Endolysin (chains A)
MNIFEMLRIDEGLRLKIYKDTEGYYHIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITK
DEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRM
LQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKNL

Ligands and cofactors

ID	Name	Formula	Copies
HEZ	Hexane-1,6-diol	C6 H14 O2	4

Water and common crystallization additives (GOL, CL, NA) are not listed.

Primary citation

Neutron structure of the T26H mutant of T4 phage lysozyme provides insight into the catalytic activity of the mutant enzyme and how it differs from that of wild type. Hiromoto, T., Meilleur, F., Shimizu, R. et al. Protein Sci (2017) 26:1953-1963. DOI 10.1002/pro.3230 · PubMed

Other PDB entries of the same protein (UniProt P00720), best resolution first:

2O7A 0.84 Å, T4 lysozyme C-terminal fragment
5JDT 1.0 Å, Structure of Spin-labelled T4 lysozyme mutant L118C-R1 at 100K
7LOE 1.01 Å, T4 lysozyme mutant L99A in complex with 1-fluoranylnaphthalene
7LOD 1.02 Å, T4 lysozyme mutant L99A in complex with 1-fluoranyl-4-iodanyl-benzene
7LX8 1.03 Å, T4 lysozyme mutant L99A
6BG3 1.05 Å, Structure of (3S,4S)-1-benzyl-4-(3-(3-(trifluoromethyl)phenyl)ureido)piperidin-3-yl…
7LOF 1.05 Å, T4 lysozyme mutant L99A in complex with 2-butylthiophene
7LX6 1.05 Å, T4 lysozyme mutant L99A
7LX7 1.05 Å, T4 lysozyme mutant L99A
1SWY 1.06 Å, Use of a Halide Binding Site to Bypass the 1000-atom Limit to Ab initio Structure…
1SWZ 1.06 Å, Use of an ion-binding site to bypass the 1000-atom limit to ab initio structure…
1SX2 1.06 Å, Use of a Halide Binding Site to Bypass the 1000-atom Limit to Structure Determination by…

Browse structure collections

About this viewer

MolViewer shows 5XPF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.