2O7A: T4 lysozyme C-terminal fragment

T4 lysozyme C-terminal fragment. Determined by X-ray diffraction at 0.84 Å resolution. Released 10 Apr 2007.

Method: X-ray diffraction
Resolution: 0.84 Å
Organism: Enterobacteria phage T4
Chains: 1
Atoms: 1,566
Mol. weight: 14.13 kDa
Released: 10 Apr 2007

Explore 2O7A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2O7A contains 10 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	62-64	3
α-helix	68-79	12
α-helix	85-90	6
α-helix	93-106	14
α-helix	108-112	5
α-helix	115-122	8
α-helix	126-133	8
α-helix	137-141	5
α-helix	143-155	13
α-helix	173-181	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Lysozyme	A	protein	124	Enterobacteria phage T4	P00720

Sequence of entity 1 (A), FASTA

>2O7A_1 Lysozyme (chains A)
MKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSL
RMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKNLSGGGGAMDIFEMLR
IDEG

Primary citation

Exploring subdomain cooperativity in T4 lysozyme I: Structural and energetic studies of a circular permutant and protein fragment. Cellitti, J., Llinas, M., Echols, N. et al. Protein Sci (2007) 16:842-851. DOI 10.1110/ps.062628607 · PubMed

Other PDB entries of the same protein (UniProt P00720), best resolution first:

5JDT 1.0 Å, Structure of Spin-labelled T4 lysozyme mutant L118C-R1 at 100K
7LOE 1.01 Å, T4 lysozyme mutant L99A in complex with 1-fluoranylnaphthalene
7LOD 1.02 Å, T4 lysozyme mutant L99A in complex with 1-fluoranyl-4-iodanyl-benzene
7LX8 1.03 Å, T4 lysozyme mutant L99A
5XPF 1.04 Å, High-resolution X-ray structure of the T26H mutant of T4 lysozyme
6BG3 1.05 Å, Structure of (3S,4S)-1-benzyl-4-(3-(3-(trifluoromethyl)phenyl)ureido)piperidin-3-yl…
7LOF 1.05 Å, T4 lysozyme mutant L99A in complex with 2-butylthiophene
7LX6 1.05 Å, T4 lysozyme mutant L99A
7LX7 1.05 Å, T4 lysozyme mutant L99A
1SWY 1.06 Å, Use of a Halide Binding Site to Bypass the 1000-atom Limit to Ab initio Structure…
1SWZ 1.06 Å, Use of an ion-binding site to bypass the 1000-atom limit to ab initio structure…
1SX2 1.06 Å, Use of a Halide Binding Site to Bypass the 1000-atom Limit to Structure Determination by…

Browse structure collections

About this viewer

MolViewer shows 2O7A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.