1T2Q: Fab NNA7 Heavy Chain

The Crystal Structure of an NNA7 Fab that recognizes an N-type blood group antigen. Determined by X-ray diffraction at 1.83 Å resolution. Released 7 Jun 2005.

Method: X-ray diffraction
Resolution: 1.83 Å
Organism: Mus musculus
Chains: 2
Atoms: 3,922
Mol. weight: 47.82 kDa
Released: 7 Jun 2005

Explore 1T2Q in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1T2Q contains 14 α-helices and 46 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 6 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-8	5	7
β-strand	12-13	2	8
β-strand	19-26	8	7
β-strand	35-41	7	9
β-strand	45-52	8	9
β-strand	58-60	3	9
β-strand	68-73	6	7
β-strand	78-83	6	7
α-helix	88-90	3
β-strand	92-99	8	9
α-helix	101-103	3
β-strand	106-109	4	9
β-strand	113-115	3	9
β-strand	116-117	2	8
β-strand	123	1	10
α-helix	124-125	2
β-strand	126-130	5	11
β-strand	141-151	11	11
β-strand	152	1	10
β-strand	157-160	4	12
α-helix	161-163	3
β-strand	165	1	12
β-strand	169-171	3	11
α-helix	172-174	3
β-strand	175-177	3	11
β-strand	180-190	11	11
β-strand	200-205	6	12
α-helix	206-208	3
β-strand	210-215	6	12

Chain L: 8 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	5-8	4	1
β-strand	11-14	4	2
β-strand	20-26	7	1
β-strand	31	1	3
β-strand	37	1	3
β-strand	39-44	6	2
α-helix	49-50	2
β-strand	51-55	5	2
β-strand	59-60	2	2
α-helix	61	1
β-strand	68-73	6	1
β-strand	76-81	6	1
α-helix	86-88	3
β-strand	90-96	7	2
α-helix	102	1
β-strand	103-104	2	2
β-strand	108-112	5	2
β-strand	117	1	4
β-strand	120-124	5	5
α-helix	125-127	3
α-helix	128-132	5
β-strand	135-145	11	5
β-strand	146	1	4
β-strand	151-156	6	6
β-strand	159-161	3	6
β-strand	165-169	5	5
α-helix	170-173	4
β-strand	179-188	10	5
α-helix	189-192	4
β-strand	197-203	7	6
β-strand	211-216	6	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fab NNA7 Heavy Chain	L	protein	217	Mus musculus	A2NHM3 (AlphaFold model)
Fab NNA7 Light Chain	H	protein	221	Mus musculus	P01821 (AlphaFold model)

Sequence of entity 1 (L), FASTA

>1T2Q_1 Fab NNA7 Heavy Chain (chains L)
ELVMTQSPLSLPVSLGDQASISCRSSQSLVHSSGNTYLHWYLQKPGQSPKLLIYKVSNRF
SGVPDRFSGSGSGTDFTLTISRVEAEDLGVYYCFQGSHVPLTFGAGTKLELKRADAAPTV
SIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSM
SSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN

Sequence of entity 2 (H), FASTA

>1T2Q_2 Fab NNA7 Light Chain (chains H)
EVQLLEESGPGLVQPSQSLSITCTVSGFSLTSYGVHWVRQSPGKGLEWLGVIWSGGSTDY
NAAFISRLSISKDNSKSQVFFKMNSLQADDTAIYYCARNRGYSYAMDSWGQGTSVTVSSA
KTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDL
YTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC

Primary citation

Crystal Structure and Mutational Analysis of an Antibody that Recognizes an N-type Blood Group Antigen. Xie, K., Song, S.C., Spitalnik, S.L. et al. To be published.

Other PDB entries of the same protein (UniProt A2NHM3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6PXR 1.56 Å, Anti-TAU BIIB092 FAB with TAU peptide
4TPR 1.6 Å, Structure of Tau5 antibody Fab fragment
4TQE 1.6 Å, Structure of tau peptide in complex with Tau5 antibody Fab fragment
3V4U 1.64 Å, Structure of a monoclonal antibody complexed with its MHC-I antigen
3UO1 1.64 Å, Structure of a monoclonal antibody complexed with its MHC-I antigen
2IPU 1.65 Å, PFA1 Fab fragment complexed with Abeta 1-8 peptide
3V52 1.7 Å, Structure of a monoclonal antibody complexed with its MHC-I antigen
2DQU 1.7 Å, Crystal form II: high resolution crystal structure of the complex of the hydrolytic…
3UYR 1.7 Å, Structure of a monoclonal antibody complexed with its MHC-I antigen
1ZEA 1.78 Å, Structure of the anti-cholera toxin antibody Fab fragment TE33 in complex with a D-peptide
1PZ5 1.8 Å, Structural basis of peptide-carbohydrate mimicry in an antibody combining site
2DQT 1.8 Å, High resolution crystal structure of the complex of the hydrolytic antibody Fab 6D9 and…

Browse structure collections

About this viewer

MolViewer shows 1T2Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.