1T45: PDB entry 1T45

Structural basis for the autoinhibition and sti-571 inhibition of C-kit tyrosine kinase. Determined by X-ray diffraction at 1.9 Å resolution. Released 15 Jun 2004.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,817
Mol. weight: 37.67 kDa
Released: 15 Jun 2004

Explore 1T45 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1T45 contains 23 α-helices and 18 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 23 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	549-551	3
β-strand	558-559	2	1
β-strand	560	1	2
β-strand	570	1	2
α-helix	573-575	3
α-helix	580-582	3
β-strand	583	1	3
α-helix	586-588	3
β-strand	589-597	9	3
β-strand	601-609	9	3
β-strand	617-625	9	3
α-helix	631-647	17
β-strand	653	1	4
β-strand	656-660	5	3
β-strand	667-671	5	3
β-strand	676-677	2	4
α-helix	678-690	13
α-helix	754-756	3
β-strand	757	1	5
β-strand	760	1	5
α-helix	762-764	3
α-helix	766-785	20
β-strand	788-789	2	1
α-helix	795-797	3
β-strand	798-801	4	4
α-helix	802-804	3
β-strand	805-808	4	4
α-helix	812-814	3
α-helix	817-819	3
β-strand	824-825	2	6
β-strand	830-831	2	6
α-helix	833-835	3
α-helix	838-843	6
α-helix	848-863	16
α-helix	867-868	2
α-helix	877-885	9
α-helix	889-892	4
α-helix	897-906	10
α-helix	911-913	3
α-helix	915-916	2
α-helix	917-930	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Homo sapiens v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog	A	protein	331	Homo sapiens	P10721 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1T45_1 Homo sapiens v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog (chains A)
YLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAGAFGKVVEA
TAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIVNLLGACTIGGPT
LVITEYCCYGDLLNFLRRKRDSFICSKTSPAIMEDDELALDLEDLLSFSYQVAKGMAFLA
SKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVKWMAPESIFNC
VYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMYDIMK
TCWDADPLKRPTFKQIVQLIEKQISESTNHI

Primary citation

Structural basis for the autoinhibition and STI-571 inhibition of c-Kit tyrosine kinase. Mol, C.D., Dougan, D.R., Schneider, T.R. et al. J Biol Chem (2004) 279:31655-31663. DOI 10.1074/jbc.M403319200 · PubMed

Other PDB entries of the same protein (UniProt P10721 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2VIF 1.45 Å, Crystal structure of SOCS6 SH2 domain in complex with a c-KIT phosphopeptide
8PQD 1.5 Å, c-KIT kinase domain in complex with avapritinib derivative 10
8S14 1.5 Å, c-KIT kinase domain in complex with sunitinib
1T46 1.6 Å, Structural basis for the autoinhibition and sti-571 inhibition of C-kit tyrosine kinase
3G0E 1.6 Å, KIT kinase domain in complex with sunitinib
8PQA 1.65 Å, c-KIT kinase domain in complex with avapritinib derivative 4
9TFD 1.65 Å, KIT kinase domain in complex with a pyrrolotriazine-based compound (11)
8PQ9 1.7 Å, c-KIT kinase domain in complex with avapritinib
9TFE 1.7 Å, KIT kinase domain in complex with an aminopyrimidine-based compound (15)
9TFG 1.7 Å, KIT kinase domain in complex with a 6-,7-dimethoxyquinoline-based compound (19)
9TFH 1.7 Å, KIT kinase domain in complex with a 7-methylquinazoline-based compound (25)
9TFK 1.7 Å, KIT kinase domain in complex with a quinoline-3-carbonitrile-based compound (38)

Browse structure collections

About this viewer

MolViewer shows 1T45 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.