1T6N: N-terminal domain of human UAP56

Crystal structure of the N-terminal domain of human UAP56. Determined by X-ray diffraction at 1.94 Å resolution. Released 31 Aug 2004.

Method: X-ray diffraction
Resolution: 1.94 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,649
Mol. weight: 50.48 kDa
Ligands: FLC
Released: 31 Aug 2004

Explore 1T6N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1T6N contains 18 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	54-62	9
α-helix	70-80	11
β-strand	85-88	4	1
α-helix	95-106	12
β-strand	116-119	4	1
α-helix	123-136	14
β-strand	145-148	4	1
α-helix	154-163	10
β-strand	168-171	4	1
α-helix	173-181	9
β-strand	192-196	5	1
α-helix	198-202	5
α-helix	205-216	12
β-strand	223-228	6	1
α-helix	236-240	5
β-strand	247-250	4	1

Chain B: 9 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	54-62	9
α-helix	70-79	10
β-strand	85-88	4	2
α-helix	95-106	12
β-strand	116-119	4	2
α-helix	123-136	14
β-strand	145-148	4	2
α-helix	154-163	10
β-strand	168-171	4	2
α-helix	173-181	9
β-strand	192-196	5	2
α-helix	198-203	6
α-helix	205-216	12
β-strand	223-228	6	2
α-helix	236-240	5
β-strand	247-250	4	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Probable ATP-dependent RNA helicase	A, B	protein	220	Homo sapiens	Q13838 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1T6N_1 Probable ATP-dependent RNA helicase (chains A, B)
GSDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKS
GMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGG
LSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDV
QEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFV

Ligands and cofactors

ID	Name	Formula	Copies
FLC	Citrate anion	C6 H5 O7	2

Primary citation

Crystal Structure of UAP56, a DExD/H-Box Protein Involved in Pre-mRNA Splicing and mRNA Export. Zhao, R., Shen, J., Green, M.R. et al. Structure (2004) 12:1373-1381. DOI 10.1016/j.str.2004.06.006 · PubMed

Other PDB entries of the same protein (UniProt Q13838 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1T5I 1.9 Å, Crystal structure of the C-terminal domain of UAP56
1XTI 1.95 Å, Structure of Wildtype human UAP56
1XTK 2.4 Å, structure of DECD to DEAD mutation of human UAP56
8ENK 2.5 Å, Crystal structure of UAP56 in complex with Tho1, the yeast homolog of human SARNP
9RV1 2.62 Å, Cryo-EM structure of the human UAP56-RNA - SAC3D1-PCID2-SEM1 complex
1XTJ 2.7 Å, structure of human UAP56 in complex with ADP
9DLP 2.79 Å, Cryo-EM structure of human TREX-2 complex bound to DDX39B(UAP56)
9T6L 2.9 Å, Cryo-EM structure of the human LENG8-PCID2-DSS1 complex bound to UAP56 and RRP1B
9DLV 2.97 Å, Cryo-EM structure of the human TREX-2.1 complex (LENG8/PCID2/DSS1) bound to DDX39B(UAP56)
9T6N 3.0 Å, Cryo-EM structure of the human GANP-PCID2-DSS1 complex bound to UAP56
9DLR 3.08 Å, Cryo-EM structure of the human TREX-2.1 complex (LENG8/PCID2/DSS1) bound to the…
7APK 3.3 Å, Structure of the human THO - UAP56 complex

Browse structure collections

About this viewer

MolViewer shows 1T6N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.