1T83: Human type III fc gamma receptor

Crystal structure of a human type III fc gamma receptor in complex with an fc fragment of IgG1 (orthorhombic). Determined by X-ray diffraction at 3.0 Å resolution. Released 28 Sept 2004.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 3
Atoms: 5,037
Mol. weight: 73.88 kDa
Ligands: HG2
Released: 28 Sept 2004

Explore 1T83 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1T83 contains 17 α-helices and 61 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	239-243	5	1
α-helix	247-251	5
β-strand	258-266	9	1
β-strand	274-279	6	2
β-strand	282-284	3	2
β-strand	288-289	2	1
β-strand	300-307	8	1
α-helix	310-315	6
β-strand	321-324	4	2
β-strand	332-334	3	2
α-helix	338-340	3
β-strand	344	1	3
β-strand	347-351	5	4
α-helix	352-354	3
α-helix	355-358	4
β-strand	362-372	11	4
β-strand	373	1	3
β-strand	378-382	5	5
β-strand	387	1	5
β-strand	391-393	3	4
α-helix	394-396	3
β-strand	397-398	2	4
β-strand	404-413	10	4
α-helix	414-419	6
β-strand	423-428	6	5
β-strand	437-441	5	5

Chain B: 6 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	239-243	5	6
α-helix	247-251	5
β-strand	258-266	9	6
β-strand	274	1	7
β-strand	277-279	3	8
β-strand	282-284	3	8
β-strand	287-290	4	6
β-strand	293-294	2	6
β-strand	299-307	9	6
α-helix	310-314	5
β-strand	319-323	5	8
β-strand	324	1	7
β-strand	332-336	5	8
α-helix	338-340	3
β-strand	344	1	9
β-strand	347-351	5	10
α-helix	352-354	3
α-helix	355-357	3
β-strand	362-372	11	10
β-strand	373	1	9
β-strand	378-382	5	11
β-strand	387	1	11
β-strand	391-393	3	10
β-strand	397-398	2	10
β-strand	404-413	10	10
α-helix	414-418	5
β-strand	423-428	6	11
β-strand	437-441	5	11

Chain C: 4 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	7	1	12
β-strand	9-13	5	13
β-strand	18-20	3	14
β-strand	25-30	6	13
β-strand	41-44	4	15
β-strand	47-49	3	15
β-strand	55-58	4	13
α-helix	63-65	3
β-strand	67-68	2	16
β-strand	69-72	4	15
β-strand	77	1	12
α-helix	79-81	3
β-strand	83-84	2	16
β-strand	85-87	3	14
β-strand	91-94	4	17
β-strand	106-112	7	17
α-helix	113-115	3
β-strand	118-125	8	18
β-strand	129-135	7	18
β-strand	138-141	4	17
β-strand	150-158	9	18
β-strand	161-164	4	18
α-helix	166-167	2
β-strand	168-170	3	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
IGG1	A, B	protein	224	Homo sapiens	P01857 (AlphaFold model)
Low affinity immunoglobulin gamma Fc region receptor III-B	C	protein	176	Homo sapiens	O75015 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1T83_1 IGG1 (chains A, B)
HTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVE
VHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQP
REPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGS
FFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Sequence of entity 2 (C), FASTA

>1T83_2 Low affinity immunoglobulin gamma Fc region receptor III-B (chains C)
RTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDA
ATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHK
VTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGL

Ligands and cofactors

ID	Name	Formula	Copies
HG2	Dibromomercury	Br2 Hg	1

Primary citation

The structure of a human type III Fcgamma receptor in complex with Fc. Radaev, S., Motyka, S., Fridman, W.-H. et al. J Biol Chem (2001) 276:16469-16477. DOI 10.1074/jbc.M100350200 · PubMed

Other PDB entries of the same protein (UniProt P01857 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4LLD 1.19 Å, Structure of wild-type IgG1 antibody heavy chain constant domain 1 and light chain…
3TV3 1.29 Å, Crystal structure of broad and potent HIV-1 neutralizing antibody PGT128 in complex with…
4LLQ 1.42 Å, Structure of redesigned IgG1 first constant and lambda domains (CH1:Clambda constant…
5HSF 1.52 Å, 1.52 Angstrom Crystal Structure of Fc fragment of Human IgG1.
6YT7 1.55 Å, Glycosylated knob/dummy-hole fc fragment
4NWU 1.6 Å, Crystal structure of APE1551, an anti-human NGF Fab with a nine amino acid insertion in…
1L6X 1.65 Å, Fc fragment of rituximab bound to a minimized version of the B-domain from protein A…
3TWC 1.65 Å, Crystal structure of broad and potent HIV-1 neutralizing antibody PGT127 in complex with…
5JIH 1.66 Å, Crystal structure of HER2 binding IgG1-Fc (Fcab STAB19)
3MCL 1.7 Å, Anti-beta-amyloid antibody c706 fab in space group P21
5U66 1.7 Å, Modified single helix from the B-domain of protein A bound to IgG1 Fc
6N35 1.75 Å, Anti-HIV-1 Fab 2G12 + Man1-2 re-refinement

Browse structure collections

About this viewer

MolViewer shows 1T83 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.