1T84: Wiskott-Aldrich syndrome protein

Solution structure of the Wiskott-Aldrich Syndrome Protein (WASP) autoinhibited core domain complexed with (S)-wiskostatin, a small molecule inhibitor. Determined by solution NMR. Released 13 Jul 2004.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 836
Mol. weight: 12.03 kDa
Ligands: WSK
Released: 13 Jul 2004

Explore 1T84 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1T84 contains 6 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	19-21	3
α-helix	24-33	10
α-helix	37-40	4
α-helix	43-55	13
α-helix	59-66	8
α-helix	82-93	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Wiskott-Aldrich syndrome protein	A	protein	107	Homo sapiens	P42768 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1T84_1 Wiskott-Aldrich syndrome protein (chains A)
SGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGLE
AVRQEMRRQGGSGGSQSSEGLVGALMHVMQKRSRAIHSSDEGEDQAG

Ligands and cofactors

ID	Name	Formula	Copies
WSK	(2S)-1-(3,6-dibromo-9H-carbazol-9-yl)-3-(dimethylamino)propan-2-ol	C17 H18 Br2 N2 O	1

Primary citation

Chemical inhibition of N-WASP by stabilization of a native autoinhibited conformation. Peterson, J.R., Bickford, L.C., Morgan, D. et al. Nat Struct Mol Biol (2004) 11:747-755. DOI 10.1038/nsmb796 · PubMed

Other PDB entries of the same protein (UniProt P42768 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2OT0 2.05 Å, Fructose-1,6-bisphosphate aldolase from rabbit muscle in complex with a C-terminal…
2A3Z 2.08 Å, Ternary complex of the WH2 domain of WASP with Actin-DNAse I
1CEE Solution structure of CDC42 in complex with the gtpase binding domain of wasp
1EJ5 Solution structure of the autoinhibited conformation of wasp
2K42 Solution Structure of the GTPase Binding Domain of WASP in Complex with EspFU, an EHEC…
9S9X Human WASP/WIP complex

Browse structure collections

About this viewer

MolViewer shows 1T84 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.