Crystal Structure of apo acyl carrier protein from E. coli. Determined by X-ray diffraction at 1.1 Å resolution. Released 7 Sept 2004.
Explore 1T8K in 3D Show helices and sheets RCSB PDB PDBe
1T8K contains 5 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-15 | 13 | |
| α-helix | 19-21 | 3 | |
| β-strand | 27 | 1 | 1 |
| α-helix | 36-50 | 15 | |
| α-helix | 56-59 | 4 | |
| β-strand | 64 | 1 | 1 |
| α-helix | 65-74 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Acyl carrier protein | A | protein | 77 | Escherichia coli | P0A6A8 (AlphaFold model) |
>1T8K_1 Acyl carrier protein (chains A) STIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAE KITTVQAAIDYINGHQA
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 10 |
Water and common crystallization additives (IMD) are not listed.
Structure of apo acyl carrier protein and a proposal to engineer protein crystallization through metal ions. Qiu, X., Janson, C.A. Acta Crystallogr D Biol Crystallogr (2004) 60:1545-1554. DOI 10.1107/S0907444904015422 · PubMed
Other PDB entries of the same protein (UniProt P0A6A8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1T8K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.