1TIM: Triose phosphate isomerase from chicken muscle

Structure of triose phosphate isomerase from chicken muscle. Determined by X-ray diffraction at 2.5 Å resolution. Released 15 Oct 1976.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Gallus gallus
Chains: 2
Atoms: 3,740
Mol. weight: 53.16 kDa
Released: 15 Oct 1976

Explore 1TIM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1TIM contains 26 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	7-11	5	1
β-strand	14	1	2
α-helix	18-30	13
β-strand	38-42	5	1
α-helix	47-54	8
β-strand	59-64	6	1
β-strand	72	1	3
α-helix	80-86	7
β-strand	90-93	4	1
α-helix	96-102	7
α-helix	106-118	13
β-strand	123-129	7	1
α-helix	131-136	6
α-helix	139-153	15
β-strand	160-166	7	1
α-helix	167-169	3
α-helix	178-196	19
α-helix	198-203	6
β-strand	205-208	4	1
α-helix	216-221	6
β-strand	228-231	4	1
α-helix	233-236	4
α-helix	239-244	6

Chain B: 13 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	7-11	5	4
β-strand	14	1	3
α-helix	18-30	13
β-strand	38-42	5	4
α-helix	45-54	10
β-strand	60-63	4	4
β-strand	72	1	2
α-helix	80-86	7
β-strand	90-93	4	4
α-helix	96-101	6
α-helix	106-118	13
α-helix	121	1
β-strand	122-129	8	4
α-helix	131-136	6
α-helix	139-153	15
β-strand	160-166	7	4
α-helix	178-195	18
α-helix	198-203	6
β-strand	205-208	4	4
α-helix	214-222	9
β-strand	228-231	4	4
α-helix	233-236	4
α-helix	239-245	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Triosephosphate isomerase	A, B	protein	247	Gallus gallus	P00940 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1TIM_1 TRIOSEPHOSPHATE ISOMERASE (chains A, B)
APRKFFVGGNWKMNGKRKSLGELIHTLDGAKLSADTEVVCGAPSIYLDFARQKLDAKIGV
AAQNCYKVPKGAFTGEISPAMIKDIGAAWVILGHSERRHVFGESDELIGQKVAHALAEGL
GVIACIGEKLDEREAGITEKVVFQETKAIADNVKDWSKVVLAYEPVWAIGTGKTATPQQA
QEVHEKLRGWLKTHVSDAVAVQSRIIYGGSVTGGNCKELASQHDVDGFLVGGASLKPEFV
DIINAKH

Primary citation

Atomic coordinates for triose phosphate isomerase from chicken muscle. Banner, D.W., Bloomer, A., Petsko, G.A. et al. Biochem Biophys Res Commun (1976) 72:146-155. PubMed

Other PDB entries of the same protein (UniProt P00940 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4P61 1.34 Å, Chicken triosephosphate isomerase with LOOP6 mutations, V167P and W168E.
1SW0 1.71 Å, Triosephosphate isomerase from Gallus gallus, loop 6 hinge mutant K174L, T175W
1TPH 1.8 Å, 1.8 Å crystal structure of wild type chicken triosephosphate…
1TPB 1.9 Å, Offset of a catalytic lesion by a bound water soluble
1TPC 1.9 Å, Offset of a catalytic lesion by a bound water soluble
1TPU 1.9 Å, S96P change is a second-site suppressor for H95N sluggish mutant triosephosphate isomerase
1TPV 1.9 Å, S96P change is a second-site suppressor for H95N sluggish mutant triosephosphate isomerase
1TPW 1.9 Å, Triosephosphate isomerase drinks water to keep healthy
1SW3 2.03 Å, Triosephosphate isomerase from Gallus gallus, loop 6 mutant T175V
1SPQ 2.16 Å, Understanding protein lids: Structural analysis of active hinge mutants in…
1SW7 2.22 Å, Triosephosphate isomerase from Gallus gallus, loop 6 mutant K174N, T175S, A176S
8TIM 2.5 Å, Triose phosphate isomerase

Browse more

1TIM is part of these collections:

About this viewer

MolViewer shows 1TIM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.