1TNR: Tumor necrosis factor beta

Crystal structure of the soluble human 55 kd tnf receptor-human tnf-beta complex: implications for tnf receptor activation. Determined by X-ray diffraction at 2.85 Å resolution. Released 31 Jul 1994.

Method: X-ray diffraction
Resolution: 2.85 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,254
Mol. weight: 31.64 kDa
Released: 31 Jul 1994

Explore 1TNR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1TNR contains 11 α-helices and 39 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	30-35	6	1
β-strand	45-46	2	1
β-strand	49	1	2
β-strand	53-55	3	1
β-strand	59-61	3	3
β-strand	64-66	3	3
α-helix	67	1
β-strand	71-83	13	1
β-strand	85	1	4
α-helix	88-91	4
β-strand	95-104	10	3
β-strand	112-121	10	3
β-strand	124	1	5
β-strand	125	1	4
β-strand	127	1	5
β-strand	129-141	13	1
β-strand	146-152	7	3
α-helix	154-156	3
β-strand	157	1	1
β-strand	165-170	6	1

Chain R: 8 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	6
β-strand	19-22	4	6
β-strand	25-31	7	6
α-helix	32	1
β-strand	33	1	7
α-helix	34	1
β-strand	37-41	5	8
β-strand	51-54	4	8
α-helix	55-56	2
β-strand	57	1	9
β-strand	59-60	2	9
β-strand	65	1	7
β-strand	70	1	2
β-strand	71-72	2	9
α-helix	73-76	4
α-helix	78-80	3
β-strand	83-86	4	10
β-strand	89	1	11
β-strand	92	1	11
β-strand	95-97	3	10
β-strand	100	1	12
β-strand	102-106	5	12
β-strand	112-116	5	12
α-helix	117-118	2
β-strand	123-127	5	13
α-helix	134-135	2
β-strand	136-139	4	13
α-helix	140	1
β-strand	143-145	3	14
β-strand	150-152	3	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tumor necrosis factor beta	A	protein	144	Homo sapiens	P01374 (AlphaFold model)
Tumor necrosis factor receptor P55	R	protein	139	Homo sapiens	P19438 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1TNR_1 TUMOR NECROSIS FACTOR BETA (chains A)
KPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYS
PKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQL
STHTDGIPHLVLSPSTVFFGAFAL

Sequence of entity 2 (R), FASTA

>1TNR_2 TUMOR NECROSIS FACTOR RECEPTOR P55 (chains R)
CPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCS
KCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQN
TVCTCHAGFFLRENECVSC

Primary citation

Crystal structure of the soluble human 55 kd TNF receptor-human TNF beta complex: implications for TNF receptor activation. Banner, D.W., D'Arcy, A., Janes, W. et al. Cell (1993) 73:431-445. DOI 10.1016/0092-8674(93)90132-a · PubMed

Other PDB entries of the same protein (UniProt P01374 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4MXV 3.2 Å, Structure of Lymphotoxin alpha bound to anti-LTa Fab
4MXW 3.6 Å, Structure of heterotrimeric lymphotoxin LTa1b2 bound to lymphotoxin beta receptor LTbR…

Browse structure collections

About this viewer

MolViewer shows 1TNR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.