Crystal structure of PDZ3 domain of PSD-95 protein complexed with a peptide ligand KKETWV. Determined by X-ray diffraction at 1.54 Å resolution. Released 20 Sept 2005.
Explore 1TP5 in 3D Show helices and sheets RCSB PDB PDBe
1TP5 contains 6 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 302-304 | 3 | |
| α-helix | 306-308 | 3 | |
| β-strand | 312-317 | 6 | 1 |
| β-strand | 325-329 | 5 | 1 |
| α-helix | 331-333 | 3 | |
| β-strand | 336-341 | 6 | 1 |
| α-helix | 346-350 | 5 | |
| β-strand | 357-362 | 6 | 1 |
| β-strand | 365-366 | 2 | 1 |
| α-helix | 372-380 | 9 | |
| β-strand | 385-392 | 8 | 1 |
| α-helix | 394-398 | 5 | |
| β-strand | 404-406 | 3 | 2 |
| β-strand | 412-414 | 3 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 423-424 | 2 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Presynaptic density protein 95 | A | protein | 119 | Rattus norvegicus | P31016 (AlphaFold model) |
| LYS-LYS-GLU-THR-TRP-VAL peptide ligand | B | protein | 6 |
>1TP5_1 Presynaptic density protein 95 (chains A) GSPEFLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKG DQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEANSRVDSSGRIVTD
>1TP5_2 LYS-LYS-GLU-THR-TRP-VAL peptide ligand (chains B) KKETWV
Structure of the third PDZ domain of PSD-95 protein complexed with KKETWV peptide ligand. Saro, D., Wawrzak, Z., Martin, P. et al. To be published.
Other PDB entries of the same protein (UniProt P31016 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1TP5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.