1TQE: Myocyte-specific enhancer factor 2B

Mechanism of recruitment of class II histone deacetylases by myocyte enhancer factor-2. Determined by X-ray diffraction at 2.7 Å resolution. Released 21 Dec 2004.

Method: X-ray diffraction
Resolution: 2.7 Å
Organisms: Homo sapiens, Mus musculus
Chains: 10
Atoms: 4,730
Mol. weight: 70.51 kDa
Released: 21 Dec 2004

Explore 1TQE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1TQE contains 14 α-helices and 10 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains P and R: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	16-38	23
β-strand	42-48	7	1
β-strand	54-58	5	1
α-helix	62-71	10
α-helix	81-90	10

Chain Q: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	16-38	23
β-strand	42-48	7	1
β-strand	54-58	5	1
α-helix	62-70	9
β-strand	77-79	3	1
α-helix	81-90	10

Chain S: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	16-38	23
β-strand	42-48	7	2
β-strand	54-58	5	2
α-helix	62-70	9
β-strand	77-80	4	2
α-helix	81-90	10

Chains X and Y: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	113-123	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
MEF2 binding site of nur77 promoter	C, E	DNA	17
MEF2 binding site of nur77 promoter	D, F	DNA	17
Myocyte-specific enhancer factor 2B	P, Q, R, S	protein	93	Homo sapiens	Q02080 (AlphaFold model)
Histone deacetylase 9	X, Y	protein	26	Mus musculus	Q99N13 (AlphaFold model)

Sequence of entity 1 (C, E), FASTA

>1TQE_1 MEF2 binding site of nur77 promoter (chains C, E)
AAAGCTATTTATAAGCA

Sequence of entity 2 (D, F), FASTA

>1TQE_2 MEF2 binding site of nur77 promoter (chains D, F)
TTGCTTATAAATAGCTT

Sequence of entity 3 (P, Q, R, S), FASTA

>1TQE_3 Myocyte-specific enhancer factor 2B (chains P, Q, R, S)
MGRKKIQISRILDQRNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSANRLFQYAST
DMDRVLLKYTEYSEPHESRTNTDILETLKRRGI

Sequence of entity 4 (X, Y), FASTA

>1TQE_4 Histone deacetylase 9 (chains X, Y)
SPKGTGASTEVKQKLQEFLLSKSATK

Primary citation

Mechanism of Recruitment of Class II Histone Deacetylases by Myocyte Enhancer Factor-2. Han, A., He, J., Wu, Y. et al. J Mol Biol (2005) 345:91-102. DOI 10.1016/j.jmb.2004.10.033 · PubMed

Other PDB entries of the same protein (UniProt Q02080 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6WC2 2.1 Å, Crystal Structure of a Ternary MEF2 Chimera/NKX2-5/myocardin enhancer DNA Complex
1N6J 2.2 Å, Structural basis of sequence-specific recruitment of histone deacetylases by Myocyte…
6BYY 2.3 Å, MEF2 CHIMERA/DNA Complex
6C9L 2.3 Å, MEF2B Apo Protein Structure
6WC5 2.9 Å, Crystal Structure of a Ternary MEF2B/NKX2-5/myocardin enhancer DNA Complex
6BZ1 2.97 Å, MEF2 Chimera D83V mutant/DNA complex

Browse structure collections

About this viewer

MolViewer shows 1TQE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.