6WC2: PDB entry 6WC2
Crystal Structure of a Ternary MEF2 Chimera/NKX2-5/myocardin enhancer DNA Complex. Determined by X-ray diffraction at 2.1 Å resolution. Released 22 Jul 2020.
- Method
- X-ray diffraction
- Resolution
- 2.1 Å
- Organisms
- Homo sapiens, synthetic construct
- Chains
- 15
- Atoms
- 8,973
- Mol. weight
- 129.72 kDa
- Released
- 22 Jul 2020
Explore 6WC2 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
6WC2 contains 30 α-helices and 18 β-strands across 9 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 3 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 14-39 | 26 | |
| β-strand | 42-48 | 7 | 1 |
| β-strand | 54-58 | 5 | 1 |
| α-helix | 62-71 | 10 | |
| β-strand | 77-79 | 3 | 1 |
| α-helix | 81-90 | 10 | |
Chain B: 3 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 14-39 | 26 | |
| β-strand | 42-48 | 7 | 1 |
| β-strand | 54-58 | 5 | 1 |
| α-helix | 62-71 | 10 | |
| β-strand | 78-79 | 2 | 1 |
| α-helix | 81-90 | 10 | |
Chain C: 3 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 14-39 | 26 | |
| β-strand | 42-48 | 7 | 2 |
| β-strand | 54-58 | 5 | 2 |
| α-helix | 62-71 | 10 | |
| β-strand | 77-79 | 3 | 2 |
| α-helix | 81-88 | 8 | |
Chain D: 3 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 14-39 | 26 | |
| β-strand | 42-48 | 7 | 2 |
| β-strand | 54-58 | 5 | 2 |
| α-helix | 62-71 | 10 | |
| β-strand | 77-79 | 3 | 2 |
| α-helix | 81-89 | 9 | |
Chain I: 3 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 14-39 | 26 | |
| β-strand | 42-48 | 7 | 3 |
| β-strand | 54-58 | 5 | 3 |
| α-helix | 62-70 | 9 | |
| β-strand | 77-79 | 3 | 3 |
| α-helix | 81-90 | 10 | |
Chain J: 3 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 14-38 | 25 | |
| β-strand | 42-48 | 7 | 3 |
| β-strand | 54-58 | 5 | 3 |
| α-helix | 62-70 | 9 | |
| β-strand | 77-79 | 3 | 3 |
| α-helix | 81-91 | 11 | |
Chain M: 4 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 143-146 | 4 | |
| α-helix | 147-159 | 13 | |
| α-helix | 165-175 | 11 | |
| α-helix | 179-193 | 15 | |
Chains N and O: 4 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 144-146 | 3 | |
| α-helix | 147-159 | 13 | |
| α-helix | 165-175 | 11 | |
| α-helix | 179-193 | 15 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| MEF2 Chimera,Myocyte-specific enhancer factor 2B,Myocyte-specific enhancer factor 2A | A, B, C, D, I, J | protein | 95 | Homo sapiens | Q02078 (AlphaFold model), Q02080 (AlphaFold model) |
| Myocardin Enhancer DNA | E, G, K | DNA | 21 | synthetic construct | |
| Myocardin Enhancer DNA | F, H, L | DNA | 21 | synthetic construct | |
| Homeobox protein Nkx-2.5 | M, N, O | protein | 61 | Homo sapiens | P52952 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D, I, J), FASTA
>6WC2_1 MEF2 Chimera,Myocyte-specific enhancer factor 2B,Myocyte-specific enhancer factor 2A (chains A, B, C, D, I, J)
MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYAST
DMDKVLLKYTEYSEPHESRTNTDILETLKRREHRG
Sequence of entity 2 (E, G, K), FASTA
>6WC2_2 Myocardin Enhancer DNA (chains E, G, K)
AAGCACTTTCTTAAAATAGTG
Sequence of entity 3 (F, H, L), FASTA
>6WC2_3 Myocardin Enhancer DNA (chains F, H, L)
CACTATTTTAAGAAAGTGCTT
Sequence of entity 4 (M, N, O), FASTA
>6WC2_4 Homeobox protein Nkx-2.5 (chains M, N, O)
RRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKSKRQ
R
Primary citation
Crystal Structures of Ternary Complexes of MEF2 and NKX2-5 Bound to DNA Reveal a Disease Related Protein-Protein Interaction Interface. Lei, X., Zhao, J., Sagendorf, J.M. et al. J Mol Biol (2020) 432:5499-5508. DOI 10.1016/j.jmb.2020.07.004 · PubMed
Other PDB entries of the same protein (UniProt Q02078 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 1EGW 1.5 Å, Crystal structure of MEF2A core bound to DNA
- 3P57 2.19 Å, Crystal structure of the p300 TAZ2 domain bound to MEF2 on DNA
- 1LEW 2.3 Å, Crystal structure of map kinase P38 complexed to the docking site on its nuclear…
- 6BYY 2.3 Å, MEF2 CHIMERA/DNA Complex
- 3MU6 2.43 Å, Inhibiting the Binding of Class IIa Histone Deacetylases to Myocyte Enhancer Factor-2 by…
- 3KOV 2.9 Å, Structure of MEF2A bound to DNA reveals a completely folded MADS-box/MEF2 domain that…
- 6BZ1 2.97 Å, MEF2 Chimera D83V mutant/DNA complex
- 7XUZ 3.59 Å, Crystal structure of a HDAC4-MEF2A-DNA ternary complex
- 1C7U Complex of the DNA binding core domain of the transcription factor MEF2A with a 20mer…
Browse structure collections
About this viewer
MolViewer shows 6WC2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.