1TRO: Protein

Crystal structure of trp repressor operator complex at atomic resolution. Determined by X-ray diffraction at 1.9 Å resolution. Released 31 Jan 1994.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Escherichia coli str. K12 substr.
Chains: 8
Atoms: 5,373
Mol. weight: 73.58 kDa
Ligands: TRP
Released: 31 Jan 1994

Explore 1TRO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1TRO contains 25 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	8-31	24
α-helix	35-42	8
α-helix	45-63	19
α-helix	68-75	8
α-helix	79-90	12
α-helix	94-102	9
α-helix	103-107	5

Chain C: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	11-31	21
α-helix	35-42	8
α-helix	45-63	19
α-helix	68-75	8
α-helix	79-91	13
α-helix	94-104	11

Chain E: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	13-31	19
α-helix	35-42	8
α-helix	45-63	19
α-helix	68-75	8
α-helix	79-91	13
α-helix	94-104	11

Chain G: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	6-31	26
α-helix	35-42	8
α-helix	45-63	19
α-helix	68-74	7
α-helix	79-90	12
α-helix	94-104	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA (5'-d(tpgptpapcptpapgptptpapapcptpapgpt pap*c)-3')	I, J, K, L	DNA	19
Protein (trp repressor)	A, C, E, G	protein	108	Escherichia coli str. K12 substr.	P0A881 (AlphaFold model)

Sequence of entity 1 (I, J, K, L), FASTA

>1TRO_1 DNA (5'-D(*TP*GP*TP*AP*CP*TP*AP*GP*TP*TP*AP*AP*CP*TP*AP*GP*T P*AP*C)-3') (chains I, J, K, L)
TGTACTAGTTAACTAGTAC

Sequence of entity 2 (A, C, E, G), FASTA

>1TRO_2 PROTEIN (TRP REPRESSOR) (chains A, C, E, G)
MAQQSPYSAAMAEERHQEWLRFVDLLKNAYQNDLHLPLLNLMLTPDEREALGTRVRIVEE
LLRGEMSQRELKNELGAGIATITRGSNSLKAAPVELRQWLEEVLLKSD

Ligands and cofactors

ID	Name	Formula	Copies
TRP	Tryptophan	C11 H12 N2 O2	4

Primary citation

Crystal structure of trp repressor/operator complex at atomic resolution. Otwinowski, Z., Schevitz, R.W., Zhang, R.G. et al. Nature (1988) 335:321-329. DOI 10.1038/335321a0 · PubMed

Other PDB entries of the same protein (UniProt P0A881 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6ENI 1.1 Å, Tryptophan Repressor TrpR from E.coli variant T44L S88Y with Indole-3-acetic acid as…
6ENN 1.17 Å, Tryptophan Repressor TrpR from E.coli variant T44L T81M N87G S88Y with Indole-3-acetic…
6FAL 1.2 Å, Tryptophan Repressor TrpR from E.coli with 3-Indolepropionic acid as ligand
1JHG 1.3 Å, Trp repressor mutant V58I
6ELG 1.38 Å, Tryptophan Repressor TrpR from E.coli variant M42F T44L T81I S88Y with…
6F9K 1.4 Å, Tryptophan Repressor TrpR from E.coli with 5-methyl-L-tryptophan as ligand
6ELB 1.44 Å, Tryptophan Repressor TrpR from E.coli variant M42F T44L T81M N87G S88Y with…
6EKP 1.46 Å, Tryptophan Repressor TrpR from E.coli variant T44L T81M S88Y with Indole-3-acetic acid…
3SSX 1.58 Å, E. coli trp aporeporessor L75F mutant
2OZ9 1.65 Å, E. coli TRP holorepressor, orthorhombic crystal form
6F7G 1.66 Å, Tryptophan Repressor TrpR from E.coli with 5-Methyltryptamine
3SSW 1.67 Å, E. coli trp aporepressor

Browse more

1TRO is part of these collections:

DNA and RNA

About this viewer

MolViewer shows 1TRO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.