6FAL: Trp operon repressor

Tryptophan Repressor TrpR from E.coli with 3-Indolepropionic acid as ligand. Determined by X-ray diffraction at 1.2 Å resolution. Released 30 Jan 2019.

Method: X-ray diffraction
Resolution: 1.2 Å
Organism: Escherichia coli
Chains: 2
Atoms: 1,869
Mol. weight: 27.15 kDa
Ligands: IOP
Released: 30 Jan 2019

Explore 6FAL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6FAL contains 13 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	11-31	21
α-helix	35-42	8
α-helix	45-63	19
α-helix	68-75	8
α-helix	79-91	13
α-helix	94-100	7
α-helix	101-105	5

Chain B: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	14-31	18
α-helix	35-42	8
α-helix	45-63	19
α-helix	68-75	8
α-helix	79-91	13
α-helix	94-104	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Trp operon repressor	A, B	protein	115	Escherichia coli	P0A881 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6FAL_1 Trp operon repressor (chains A, B)
AQQSPYSAAMAEQRHQEWLRFVDLLKNAYQNDLHLPLLNLMLTPDEREALGTRVRIVEEL
LRGEMSQRELKNELGAGIATITRGSNYLKAAPVELRQWLEEVLLKSDLEHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
IOP	Indolylpropionic acid	C11 H11 N O2	2

Primary citation

Tryptophan Repressor TrpR from E.coli: A ligand binding study. Stiel, A.C., Shanmugaratnam, S., Hocker, B. To be published.

Other PDB entries of the same protein (UniProt P0A881 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6ENI 1.1 Å, Tryptophan Repressor TrpR from E.coli variant T44L S88Y with Indole-3-acetic acid as…
6ENN 1.17 Å, Tryptophan Repressor TrpR from E.coli variant T44L T81M N87G S88Y with Indole-3-acetic…
1JHG 1.3 Å, Trp repressor mutant V58I
6ELG 1.38 Å, Tryptophan Repressor TrpR from E.coli variant M42F T44L T81I S88Y with…
6F9K 1.4 Å, Tryptophan Repressor TrpR from E.coli with 5-methyl-L-tryptophan as ligand
6ELB 1.44 Å, Tryptophan Repressor TrpR from E.coli variant M42F T44L T81M N87G S88Y with…
6EKP 1.46 Å, Tryptophan Repressor TrpR from E.coli variant T44L T81M S88Y with Indole-3-acetic acid…
3SSX 1.58 Å, E. coli trp aporeporessor L75F mutant
2OZ9 1.65 Å, E. coli TRP holorepressor, orthorhombic crystal form
6F7G 1.66 Å, Tryptophan Repressor TrpR from E.coli with 5-Methyltryptamine
3SSW 1.67 Å, E. coli trp aporepressor
3WRP 1.8 Å, Flexibility of the DNA-binding domains of trp repressor

Browse structure collections

About this viewer

MolViewer shows 6FAL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.