6F9K: Trp operon repressor

Tryptophan Repressor TrpR from E.coli with 5-methyl-L-tryptophan as ligand. Determined by X-ray diffraction at 1.4 Å resolution. Released 30 Jan 2019.

Method: X-ray diffraction
Resolution: 1.4 Å
Organism: Escherichia coli (strain K12)
Chains: 1
Atoms: 1,021
Mol. weight: 14.7 kDa
Ligands: D0Q
Released: 30 Jan 2019

Explore 6F9K in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6F9K contains 6 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	9-31	23
α-helix	35-42	8
α-helix	45-63	19
α-helix	68-75	8
α-helix	79-91	13
α-helix	94-107	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Trp operon repressor	A	protein	116	Escherichia coli (strain K12)	P0A881 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6F9K_1 Trp operon repressor (chains A)
MAQQSPYSAAMAEQRHQEWLRFVDLLKNAYQNDLHLPLLNLMLTPDEREALGTRVRIVEE
LLRGEMSQRELKNELGAGIATITRGSNSLKAAPVELRQWLEEVLLKSDLEHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
D0Q	5-methyl-L-tryptophan	C12 H14 N2 O2	4

Water and common crystallization additives (SO4) are not listed.

Primary citation

Tryptophan Repressor TrpR from E.coli: A ligand binding study. Stiel, A.C., Shanmugaratnam, S., Hocker, B. To be published.

Other PDB entries of the same protein (UniProt P0A881 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6ENI 1.1 Å, Tryptophan Repressor TrpR from E.coli variant T44L S88Y with Indole-3-acetic acid as…
6ENN 1.17 Å, Tryptophan Repressor TrpR from E.coli variant T44L T81M N87G S88Y with Indole-3-acetic…
6FAL 1.2 Å, Tryptophan Repressor TrpR from E.coli with 3-Indolepropionic acid as ligand
1JHG 1.3 Å, Trp repressor mutant V58I
6ELG 1.38 Å, Tryptophan Repressor TrpR from E.coli variant M42F T44L T81I S88Y with…
6ELB 1.44 Å, Tryptophan Repressor TrpR from E.coli variant M42F T44L T81M N87G S88Y with…
6EKP 1.46 Å, Tryptophan Repressor TrpR from E.coli variant T44L T81M S88Y with Indole-3-acetic acid…
3SSX 1.58 Å, E. coli trp aporeporessor L75F mutant
2OZ9 1.65 Å, E. coli TRP holorepressor, orthorhombic crystal form
6F7G 1.66 Å, Tryptophan Repressor TrpR from E.coli with 5-Methyltryptamine
3SSW 1.67 Å, E. coli trp aporepressor
3WRP 1.8 Å, Flexibility of the DNA-binding domains of trp repressor

Browse structure collections

About this viewer

MolViewer shows 6F9K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.