Tumor suppressor P53 complexed with DNA. Determined by X-ray diffraction at 2.2 Å resolution. Released 11 Jul 1995.
Explore 1TUP in 3D Show helices and sheets RCSB PDB PDBe
1TUP contains 16 α-helices and 37 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 103 | 1 | 1 |
| β-strand | 110-112 | 3 | 2 |
| β-strand | 124-127 | 4 | 1 |
| β-strand | 132-135 | 4 | 1 |
| β-strand | 141-146 | 6 | 2 |
| α-helix | 150-152 | 3 | |
| β-strand | 156-163 | 8 | 1 |
| α-helix | 166-168 | 3 | |
| β-strand | 172 | 1 | 1 |
| α-helix | 173 | 1 | |
| α-helix | 177-180 | 4 | |
| β-strand | 195-198 | 4 | 2 |
| β-strand | 204-207 | 4 | 1 |
| β-strand | 214-219 | 6 | 1 |
| β-strand | 230-236 | 7 | 2 |
| β-strand | 251-258 | 8 | 1 |
| β-strand | 264-274 | 11 | 1 |
| α-helix | 278-287 | 10 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 103 | 1 | 3 |
| β-strand | 110-112 | 3 | 4 |
| β-strand | 124-127 | 4 | 3 |
| β-strand | 132-135 | 4 | 3 |
| β-strand | 141-146 | 6 | 4 |
| β-strand | 156-163 | 8 | 3 |
| α-helix | 167-170 | 4 | |
| α-helix | 177-181 | 5 | |
| β-strand | 195-198 | 4 | 4 |
| β-strand | 204-207 | 4 | 3 |
| β-strand | 214-219 | 6 | 3 |
| α-helix | 222-224 | 3 | |
| β-strand | 230-236 | 7 | 4 |
| β-strand | 251-258 | 8 | 3 |
| β-strand | 264-274 | 11 | 3 |
| α-helix | 278-287 | 10 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 103 | 1 | 5 |
| α-helix | 105-107 | 3 | |
| β-strand | 110-113 | 4 | 6 |
| β-strand | 125-127 | 3 | 5 |
| β-strand | 132-136 | 5 | 5 |
| β-strand | 141-146 | 6 | 6 |
| α-helix | 151-152 | 2 | |
| β-strand | 156-163 | 8 | 5 |
| α-helix | 166-169 | 4 | |
| α-helix | 172-173 | 2 | |
| α-helix | 177-180 | 4 | |
| β-strand | 195-197 | 3 | 6 |
| β-strand | 204-207 | 4 | 5 |
| β-strand | 214-219 | 6 | 5 |
| α-helix | 222-224 | 3 | |
| β-strand | 230-236 | 7 | 6 |
| β-strand | 251-258 | 8 | 5 |
| β-strand | 264-275 | 12 | 5 |
| α-helix | 278-285 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| DNA (5'-d(*tp*tp*tp*cp*cp*tp*ap*gp*ap*cp*tp*tp*gp*cp*cp*cp*a p*ap*tp*tp*a)-3') | E | DNA | 21 | ||
| DNA (5'-d(*ap*tp*ap*ap*tp*tp*gp*gp*gp*cp*ap*ap*gp*tp*cp*tp*a p*gp*gp*ap*a)-3') | F | DNA | 21 | ||
| Protein (P53 tumor suppressor ) | A, B, C | protein | 219 | Homo sapiens | P04637 (AlphaFold model) |
>1TUP_1 DNA (5'-D(*TP*TP*TP*CP*CP*TP*AP*GP*AP*CP*TP*TP*GP*CP*CP*CP*A P*AP*TP*TP*A)-3') (chains E) TTTCCTAGACTTGCCCAATTA
>1TUP_2 DNA (5'-D(*AP*TP*AP*AP*TP*TP*GP*GP*GP*CP*AP*AP*GP*TP*CP*TP*A P*GP*GP*AP*A)-3') (chains F) ATAATTGGGCAAGTCTAGGAA
>1TUP_3 PROTEIN (P53 TUMOR SUPPRESSOR ) (chains A, B, C) SSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPP GTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFR HSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVR VCACPGRDRRTEEENLRKKGEPHHELPPGSTKRALPNNT
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 3 |
Crystal structure of a p53 tumor suppressor-DNA complex: understanding tumorigenic mutations. Cho, Y., Gorina, S., Jeffrey, P.D. et al. Science (1994) 265:346-355. PubMed
Other PDB entries of the same protein (UniProt P04637 (AlphaFold model), which also has an AlphaFold model), best resolution first:
1TUP is part of these collections:
MolViewer shows 1TUP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.