4MZI: Human mutant p53

Crystal structure of a human mutant p53. Determined by X-ray diffraction at 1.25 Å resolution. Released 15 Jan 2014.

Method: X-ray diffraction
Resolution: 1.25 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,733
Mol. weight: 22.6 kDa
Ligands: ZN
Released: 15 Jan 2014

Explore 4MZI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4MZI contains 8 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	97-99	3
β-strand	103	1	1
β-strand	110-112	3	2
α-helix	119-120	2
β-strand	124-127	4	1
β-strand	132-135	4	1
β-strand	141-146	6	2
α-helix	150-152	3
β-strand	156-163	8	1
α-helix	166-168	3
α-helix	172-173	2
α-helix	177-180	4
β-strand	195-198	4	2
β-strand	204-207	4	1
β-strand	214-219	6	1
α-helix	222-224	3
β-strand	230-236	7	2
β-strand	251-258	8	1
β-strand	264-274	11	1
α-helix	278-287	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cellular tumor antigen p53	A	protein	200	Homo sapiens	P04637 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4MZI_1 Cellular tumor antigen p53 (chains A)
MSSSVPSQKTYQGSYGFRLGFLHSGTAKFGTCTYSPALNKMFVQLAKTVPVQLYVDSTPP
PGTRVRAMAIYKQSQHMTEVVRRCPHHERSSDSDGLAPPQHLIRVEGNLRAEYLDDPNTF
RHSVVVPYEPPEVGSDYTTIYFKFMCNSSCMGGMNRRPILVIITLEDSSGNLLGRDSFEV
RVCACPGRDRRTEEENLRKK

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Primary citation

Reversal of the DNA-Binding-Induced Loop L1 Conformational Switch in an Engineered Human p53 Protein. Emamzadah, S., Tropia, L., Vincenti, I. et al. J Mol Biol (2014) 426:936-944. DOI 10.1016/j.jmb.2013.12.020 · PubMed

Other PDB entries of the same protein (UniProt P04637 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9C5S 1.01 Å, Disulfide-linked, antiparallel p53-derived peptide dimer (CV1)
3D06 1.2 Å, Human p53 core domain with hot spot mutation R249S (I)
5MHC 1.2 Å, Crystal structure of 14-3-3sigma and a p53 C-terminal 12-mer synthetic phosphopeptide
8UQR 1.22 Å, Crystal structure of the human p53 tetramerization domain
6GGC 1.24 Å, p53 cancer mutant Y220C in complex with small-molecule stabilizer PK9320
6SHZ 1.24 Å, p53 cancer mutant Y220C
6GGE 1.25 Å, p53 cancer mutant Y220C in complex with small-molecule stabilizer PK9327
3LW1 1.28 Å, Binary complex of 14-3-3 sigma and p53 pT387-peptide
5O1E 1.3 Å, p53 cancer mutant Y220C im complex with compound MB577
6RL3 1.3 Å, Fragment AZ-003 binding at the p53pT387/14-3-3 sigma interface
8E7A 1.3 Å, Crystal structure of the p53 (Y107H) core domain orthorhombic P form
5O1C 1.32 Å, p53 cancer mutant Y220C in complex with compound MB184

Browse structure collections

About this viewer

MolViewer shows 4MZI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.