8UQR: Human p53 tetramerization domain

Crystal structure of the human p53 tetramerization domain. Determined by X-ray diffraction at 1.22 Å resolution. Released 20 Dec 2023.

Method: X-ray diffraction
Resolution: 1.22 Å
Organism: Homo sapiens
Chains: 4
Atoms: 1,302
Mol. weight: 15.64 kDa
Released: 20 Dec 2023

Explore 8UQR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8UQR contains 4 α-helices and 4 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	327-332	6	1
α-helix	335-349	15

Chain B: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	328-333	6	2
α-helix	335-352	18

Chain C: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	328-333	6	1
α-helix	335-354	20

Chain D: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	327-332	6	2
α-helix	335-355	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cellular tumor antigen p53	A, B, C, D	protein	33	Homo sapiens	P04637 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>8UQR_1 Cellular tumor antigen p53 (chains A, B, C, D)
GSEYFTLQIRGRERFEMFRELNEALELKDAQAG

Primary citation

Highly Similar Tetramerization Domains from the p53 Protein of Different Mammalian Species Possess Varying Biophysical, Functional and Structural Properties. Sakaguchi, S., Nakagawa, N., Wahba, H.M. et al. Int J Mol Sci (2023) 24. DOI 10.3390/ijms242316620 · PubMed

Other PDB entries of the same protein (UniProt P04637 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9C5S 1.01 Å, Disulfide-linked, antiparallel p53-derived peptide dimer (CV1)
3D06 1.2 Å, Human p53 core domain with hot spot mutation R249S (I)
5MHC 1.2 Å, Crystal structure of 14-3-3sigma and a p53 C-terminal 12-mer synthetic phosphopeptide
6GGC 1.24 Å, p53 cancer mutant Y220C in complex with small-molecule stabilizer PK9320
6SHZ 1.24 Å, p53 cancer mutant Y220C
4MZI 1.25 Å, Crystal structure of a human mutant p53
6GGE 1.25 Å, p53 cancer mutant Y220C in complex with small-molecule stabilizer PK9327
3LW1 1.28 Å, Binary complex of 14-3-3 sigma and p53 pT387-peptide
5O1E 1.3 Å, p53 cancer mutant Y220C im complex with compound MB577
6RL3 1.3 Å, Fragment AZ-003 binding at the p53pT387/14-3-3 sigma interface
8E7A 1.3 Å, Crystal structure of the p53 (Y107H) core domain orthorhombic P form
5O1C 1.32 Å, p53 cancer mutant Y220C in complex with compound MB184

Browse structure collections

About this viewer

MolViewer shows 8UQR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.