1TZN: Protective antigen

Crystal Structure of the Anthrax Toxin Protective Antigen Heptameric Prepore bound to the VWA domain of CMG2, an anthrax toxin receptor. Determined by X-ray diffraction at 4.3 Å resolution. Released 17 Aug 2004.

Method: X-ray diffraction
Resolution: 4.3 Å
Organisms: Bacillus anthracis str., Homo sapiens
Chains: 28
Atoms: 80,570
Mol. weight: 1161.5 kDa
Ligands: CA, MG
Released: 17 Aug 2004

Explore 1TZN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1TZN contains 448 α-helices and 798 β-strands across 28 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains a, b, c, d, e, f, g, h, i, j, k, l, m and o: 9 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	1040	1	37
β-strand	1044-1050	7	38
α-helix	1053-1055	3
α-helix	1059-1070	12
β-strand	1079-1085	7	38
β-strand	1090-1096	7	38
α-helix	1099-1110	12
α-helix	1120-1132	13
α-helix	1136-1138	3
β-strand	1141-1146	6	38
α-helix	1154-1167	14
β-strand	1171-1175	5	38
α-helix	1183-1189	7
α-helix	1204-1213	10
α-helix	1214-1216	3
β-strand	1217	1	37

Chains A, B, C, D, E, F, G, H, I, J, K, L, M and O: 23 helices, 50 β-strands

Element	Residues	Length	Sheet
α-helix	185-190	6
β-strand	192-196	5	1
β-strand	201-205	5	1
α-helix	210-214	5
α-helix	235-240	6
α-helix	249-251	3
β-strand	256	1	2
β-strand	262-269	8	3
β-strand	271-273	3	4
β-strand	288-289	2	4
β-strand	292	1	3
β-strand	293	1	5
β-strand	296-297	2	6
α-helix	311-313	3
β-strand	328-333	6	6
β-strand	334	1	5
α-helix	346-350	5
β-strand	357	1	7
β-strand	358-359	2	4
β-strand	362-368	7	3
β-strand	374	1	8
α-helix	377-379	3
β-strand	381-385	5	6
β-strand	389-394	6	6
β-strand	405	1	8
β-strand	409-410	2	3
β-strand	419-420	2	3
β-strand	435	1	7
α-helix	436-445	10
β-strand	447-452	6	6
β-strand	458-461	4	9
α-helix	464-466	3
β-strand	470-476	7	9
α-helix	482-486	5
β-strand	489-493	5	2
β-strand	501-505	5	2
β-strand	508	1	10
α-helix	514-516	3
α-helix	519-520	2
β-strand	522	1	11
α-helix	523-529	7
β-strand	534	1	12
β-strand	541-542	2	12
β-strand	545-546	2	12
α-helix	547-549	3
β-strand	550-554	5	2
α-helix	556-567	12
α-helix	577-580	4
α-helix	581	1
β-strand	582	1	11
α-helix	583	1
β-strand	584	1	10
β-strand	587-593	7	2
β-strand	598	1	13
β-strand	604	1	13
α-helix	609-616	8
β-strand	621	1	14
β-strand	628-629	2	14
α-helix	633-636	4
β-strand	639-644	6	15
β-strand	645-646	2	16
β-strand	647	1	17
β-strand	654-655	2	16
β-strand	659	1	18
α-helix	660-662	3
β-strand	674-675	2	14
α-helix	679-681	3
β-strand	695-696	2	17
β-strand	698-702	5	15
β-strand	717	1	18
β-strand	724-725	2	15
β-strand	729-730	2	17
α-helix	731-733	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protective antigen	A, B, C, D, E, F, G, H, I, J, K, L, M, O	protein	562	Bacillus anthracis str.	P13423 (AlphaFold model)
Anthrax toxin receptor 2	a, b, c, d, e, f, g, h, i, j, k, l, m, o	protein	181	Homo sapiens	P58335 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J, K, L, M, O), FASTA

>1TZN_1 Protective antigen (chains A, B, C, D, E, F, G, H, I, J, K, L, M, O)
TVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWSTASDPY
SDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSQTRTISKNT
STSRTHTSEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAETMGLN
TADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYPS
KNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNFENGRVRVDT
GSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDMTLKEALKIAFGF
NEPNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELNATNIYTVLDKIKLNAKMNILIRD
KRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIVEIEDTEGLK
EVINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISNPNYKVNVYAVTKENTIINPSEN
GDTSTNGIKKILIFSKKGYEIG

Sequence of entity 2 (a, b, c, d, e, f, g, h, i, j, k, l, m, o), FASTA

>1TZN_2 Anthrax toxin receptor 2 (chains a, b, c, d, e, f, g, h, i, j, k, l, m, o)
SCRRAFDLYFVLDKSGSVANNWIEIYNFVQQLAERFVSPEMRLSFIVFSSQATIILPLTG
DRGKISKGLEDLKRVSPVGETYIHEGLKLANEQIQKAGGLKTSSIIIALTDGKLDGLVPS
YAEKEAKISRSLGASVYCVGVLDFEQAQLERIADSKEQVFPVKGGFQALKGIINSILAQS
C

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	28
MG	Magnesium ion	Mg	14

Primary citation

Structure of heptameric protective antigen bound to an anthrax toxin receptor: A role for receptor in pH-dependent pore formation. Lacy, D.B., Wigelsworth, D.J., Melnyk, R.A. et al. Proc Natl Acad Sci U S A (2004) 101:13147-13151. DOI 10.1073/pnas.0405405101 · PubMed

Other PDB entries of the same protein (UniProt P13423 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3TEW 1.45 Å, Crystal Structure of Anthrax Protective Antigen (Membrane Insertion Loop Deleted) to…
4H2A 1.62 Å, Crystal structure of wild type protective antigen to 1.62 A (pH 7.5)
3MHZ 1.7 Å, 1.7A structure of 2-fluorohistidine labeled Protective Antigen
3TEX 1.7 Å, Crystal Structure of Anthrax Protective Antigen (Membrane Insertion Loop Deleted) to…
4NAM 1.7 Å, 1.7A structure of 5-Fluoro Tryptophan Labeled Protective Antigen (W206Y)
3TEZ 1.83 Å, Crystal Structure of Anthrax Protective Antigen Mutant S337C N664C and dithiolacetone…
4EE2 1.91 Å, Crystal Structure of Anthrax Protective Antigen K446M Mutant to 1.91-A Resolution
5FR3 1.94 Å, X-ray crystal structure of aggregation-resistant protective antigen of Bacillus…
3INO 1.95 Å, 1.95A Resolution Structure of Protective Antigen Domain 4
3Q8B 2.0 Å, Crystal structure of WT Protective Antigen (pH 9.0)
3Q8E 2.1 Å, Crystal structure of Protective Antigen W346F (pH 8.5)
1ACC 2.1 Å, Anthrax protective antigen

Browse structure collections

About this viewer

MolViewer shows 1TZN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.