3INO: Protective antigen PA-63

1.95A Resolution Structure of Protective Antigen Domain 4. Determined by X-ray diffraction at 1.95 Å resolution. Released 3 Nov 2009.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Bacillus anthracis
Chains: 2
Atoms: 2,358
Mol. weight: 32.48 kDa
Released: 3 Nov 2009

Explore 3INO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3INO contains 8 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	597-598	2	1
β-strand	604-606	3	1
α-helix	609-615	7
β-strand	619-623	5	2
β-strand	626-629	4	2
α-helix	633-636	4
β-strand	639-647	9	3
β-strand	653-655	3	3
β-strand	659	1	4
β-strand	666-668	3	2
β-strand	674-677	4	2
β-strand	695-702	8	3
α-helix	703-705	3
β-strand	717	1	4
β-strand	724-730	7	3
α-helix	731-733	3

Chain B: 4 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	596-598	3	5
β-strand	604-607	4	5
α-helix	609-615	7
β-strand	619-623	5	6
β-strand	626-629	4	6
α-helix	633-636	4
β-strand	639-647	9	7
β-strand	653-655	3	7
β-strand	659	1	8
β-strand	666-668	3	6
β-strand	674-677	4	6
β-strand	695-702	8	7
α-helix	703-705	3
β-strand	717	1	8
β-strand	724-730	7	7
α-helix	731-733	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protective antigen PA-63	A, B	protein	143	Bacillus anthracis	P13423 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3INO_1 Protective antigen PA-63 (chains A, B)
GSRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIVEIEDTEGL
KEVINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISNPNYKVNVYAVTKENTIINPSE
NGDTSTNGIKKILIFSKKGYEIG

Primary citation

Domain 4 of the anthrax protective antigen maintains structure and binding to the host receptor CMG2 at low pH. Williams, A.S., Lovell, S., Anbanandam, A. et al. Protein Sci (2009) 18:2277-2286. DOI 10.1002/pro.238 · PubMed

Other PDB entries of the same protein (UniProt P13423 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3TEW 1.45 Å, Crystal Structure of Anthrax Protective Antigen (Membrane Insertion Loop Deleted) to…
4H2A 1.62 Å, Crystal structure of wild type protective antigen to 1.62 A (pH 7.5)
3MHZ 1.7 Å, 1.7A structure of 2-fluorohistidine labeled Protective Antigen
3TEX 1.7 Å, Crystal Structure of Anthrax Protective Antigen (Membrane Insertion Loop Deleted) to…
4NAM 1.7 Å, 1.7A structure of 5-Fluoro Tryptophan Labeled Protective Antigen (W206Y)
3TEZ 1.83 Å, Crystal Structure of Anthrax Protective Antigen Mutant S337C N664C and dithiolacetone…
4EE2 1.91 Å, Crystal Structure of Anthrax Protective Antigen K446M Mutant to 1.91-A Resolution
5FR3 1.94 Å, X-ray crystal structure of aggregation-resistant protective antigen of Bacillus…
3Q8B 2.0 Å, Crystal structure of WT Protective Antigen (pH 9.0)
3Q8E 2.1 Å, Crystal structure of Protective Antigen W346F (pH 8.5)
1ACC 2.1 Å, Anthrax protective antigen
3Q8F 2.1 Å, Crystal structure of 2-Fluorohistine labeled Protective Antigen (pH 5.8)

Browse structure collections

About this viewer

MolViewer shows 3INO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.