Crystal structure of Geminin coiled-coil domain. Determined by X-ray diffraction at 2.0 Å resolution. Released 16 Jul 2004.
Explore 1UII in 3D Show helices and sheets RCSB PDB PDBe
1UII contains 3 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 94-151 | 58 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 94-145 | 52 | |
| α-helix | 146-150 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Geminin | A, B | protein | 83 | Homo sapiens | O75496 (AlphaFold model) |
>1UII_1 Geminin (chains A, B) PESSENKNLGGVTQESFDLMIKENPSSQYWKEVAEKRRKALYEALKENEKLHKEIEQKDN EIARLKKENKELAEVAEHVQYMA
A dimerized coiled-coil domain and an adjoining part of geminin interact with two sites on Cdt1 for replication inhibition. Saxena, S., Yuan, P., Dhar, S.K. et al. Mol Cell (2004) 15:245-258. DOI 10.1016/j.molcel.2004.06.045 · PubMed
Other PDB entries of the same protein (UniProt O75496 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1UII directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.