7KLZ: SPOP MATH domain

Structure of SPOP MATH domain in complex with a Geminin peptide. Determined by X-ray diffraction at 3.4 Å resolution. Released 18 Aug 2021.

Method: X-ray diffraction
Resolution: 3.4 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,307
Mol. weight: 35.96 kDa
Ligands: PO4
Released: 18 Aug 2021

Explore 7KLZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7KLZ contains 11 α-helices and 22 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	30-39	10	1
α-helix	45-48	4
β-strand	52-53	2	2
β-strand	57	1	2
β-strand	67-72	6	2
β-strand	83-90	8	2
α-helix	93-94	2
β-strand	98-107	10	1
β-strand	113-118	6	1
β-strand	123-125	3	1
β-strand	130-138	9	2
α-helix	139-143	5
α-helix	145-147	3
α-helix	151-153	3
β-strand	154-164	11	1

Chain B: 5 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	29-39	11	3
β-strand	52-53	2	4
β-strand	57	1	4
β-strand	67-72	6	4
α-helix	78-80	3
β-strand	83-90	8	4
α-helix	93-94	2
β-strand	98-107	10	3
β-strand	113-118	6	3
β-strand	123-125	3	3
β-strand	130-138	9	4
α-helix	139-143	5
α-helix	145-147	3
α-helix	151-153	3
β-strand	154-164	11	3

Chain C: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	200	1	2

Chain D: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	197-199	3
β-strand	200	1	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Speckle-type POZ protein	A, B	protein	143	Homo sapiens	O43791 (AlphaFold model)
Geminin peptide	C, D	protein	15	Homo sapiens	O75496 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7KLZ_1 Speckle-type POZ protein (chains A, B)
GPGHMVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDY
LSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRGFLL
DEANGLLPDDKLTLFCEVSVVQD

Sequence of entity 2 (C, D), FASTA

>7KLZ_2 Geminin peptide (chains C, D)
AEGTVSSSTDALPCI

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	2

Primary citation

SPOP mutation induces replication over-firing by impairing Geminin ubiquitination and triggers replication catastrophe upon ATR inhibition. Ma, J., Shi, Q., Cui, G. et al. Nat Commun (2021) 12:5779-5779. DOI 10.1038/s41467-021-26049-6 · PubMed

Other PDB entries of the same protein (UniProt O43791 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3IVV 1.25 Å, Structures of SPOP-Substrate Complexes: Insights into Molecular Architectures of…
7LIN 1.44 Å, X-ray structure of SPOP MATH domain (D140G) in complex with a 53BP1 peptide
7D3D 1.45 Å, Crystal structure of SPOP bound with a peptide
9HFV 1.45 Å, MyD88 peptide_2 bound to SPOP MATH domain
7LIP 1.48 Å, X-ray structure of SPOP MATH domain (D140G)
4HS2 1.53 Å, Crystal Structure of the Human SPOP C-terminal Domain
3HQL 1.66 Å, Structures of SPOP-Substrate Complexes: Insights into Molecular Architectures of…
3HQM 1.74 Å, Structures of SPOP-Substrate Complexes: Insights into Molecular Architectures of…
3IVB 1.75 Å, Structures of SPOP-Substrate Complexes: Insights into Architectures of BTB-Cul3…
6I5P 1.81 Å, Co-crystal structure of human SPOP MATH domain (E47K) and human BRD3 fragment
6I68 1.85 Å, Co-crystal structure of human SPOP MATH domain (M117V) and human BRD3 fragment
6I41 1.9 Å, Co-crystal structure of human SPOP MATH domain (wild-type) and human BRD3 fragment

Browse structure collections

About this viewer

MolViewer shows 7KLZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.