4BRY: Geminin

The Idas:Geminin heterodimeric parallel coiled-coil. Determined by X-ray diffraction at 2.89 Å resolution. Released 2 Oct 2013.

Method: X-ray diffraction
Resolution: 2.89 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 1,175
Mol. weight: 18.34 kDa
Ligands: PO4
Released: 2 Oct 2013

Explore 4BRY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4BRY contains 3 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	94-157	64

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	178-225	48
α-helix	227-241	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Geminin	A	protein	78	HOMO SAPIENS	O75496 (AlphaFold model)
Multicilin	B	protein	73	HOMO SAPIENS	D6RGH6 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4BRY_1 GEMININ (chains A)
QESFDLMIKENPSSQYWKEVAEKRRKALYEALKENEKLHKEIEQKDNEIARLKKENKELA
EVAEHVQYMAELIERLNG

Sequence of entity 2 (B), FASTA

>4BRY_2 MULTICILIN (chains B)
PDVPPPEQYWKEVADQNQRALGDALVENNQLHVTLTQKQEEIASLKERNVQLKELASRTR
HLASVLDKLMITQ

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	2

Water and common crystallization additives (PG4) are not listed.

Primary citation

The Geminin and Idas Coiled Coils Preferentially Form a Heterodimer that Inhibits Geminin Function in DNA Replication Licensing. Caillate, C., Pefani, E.D., Gillespie, P.J. et al. J Biol Chem (2013) 288:31624. DOI 10.1074/JBC.M113.491928 · PubMed

Other PDB entries of the same protein (UniProt O75496 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1T6F 1.47 Å, Crystal Structure of the Coiled-coil Dimerization Motif of Geminin
1UII 2.0 Å, Crystal structure of Geminin coiled-coil domain
2WVR 3.3 Å, Human Cdt1:Geminin complex
7KLZ 3.4 Å, Structure of SPOP MATH domain in complex with a Geminin peptide
2LP0 The solution structure of homeodomain-protein complex

Browse structure collections

About this viewer

MolViewer shows 4BRY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.