1UII: Geminin coiled-coil domain

Crystal structure of Geminin coiled-coil domain. Determined by X-ray diffraction at 2.0 Å resolution. Released 16 Jul 2004.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,154
Mol. weight: 19.53 kDa
Released: 16 Jul 2004

Explore 1UII in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1UII contains 3 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	94-151	58

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	94-145	52
α-helix	146-150	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Geminin	A, B	protein	83	Homo sapiens	O75496 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1UII_1 Geminin (chains A, B)
PESSENKNLGGVTQESFDLMIKENPSSQYWKEVAEKRRKALYEALKENEKLHKEIEQKDN
EIARLKKENKELAEVAEHVQYMA

Primary citation

A dimerized coiled-coil domain and an adjoining part of geminin interact with two sites on Cdt1 for replication inhibition. Saxena, S., Yuan, P., Dhar, S.K. et al. Mol Cell (2004) 15:245-258. DOI 10.1016/j.molcel.2004.06.045 · PubMed

Other PDB entries of the same protein (UniProt O75496 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1T6F 1.47 Å, Crystal Structure of the Coiled-coil Dimerization Motif of Geminin
4BRY 2.89 Å, The Idas:Geminin heterodimeric parallel coiled-coil
2WVR 3.3 Å, Human Cdt1:Geminin complex
7KLZ 3.4 Å, Structure of SPOP MATH domain in complex with a Geminin peptide
2LP0 The solution structure of homeodomain-protein complex

Browse structure collections

About this viewer

MolViewer shows 1UII directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.