1UJR: WWE domain in BAB28015

Solution structure of WWE domain in BAB28015. Determined by solution NMR. Released 5 Oct 2004.

Method: Solution NMR
Organism: Mus musculus
Chains: 1
Atoms: 885
Mol. weight: 12.57 kDa
Released: 5 Oct 2004

Explore 1UJR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1UJR contains 2 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	17-28	12
β-strand	29-35	7	1
β-strand	40-42	3	1
α-helix	46-57	12
β-strand	61-66	6	2
β-strand	69-74	6	2
β-strand	79-82	4	2
β-strand	89-91	3	2
β-strand	92-97	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
hypothetical protein AK012080	A	protein	110	Mus musculus	Q9CZW6 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1UJR_1 hypothetical protein AK012080 (chains A)
PSSGSSGFLDKPTLLSPEELKAASRGNGEYAWYYEGRNGWWQYDERTSRELEDAFSKGKK
NTEMLIAGFLYVADLENMVQYRRNEHGRRRKIKRDIIDIPKKGVSGPSSG

Primary citation

Solution structure of WWE domain in BAB28015. He, F., Muto, Y., Hamana, H. et al. To be published.

Other PDB entries of the same protein (UniProt Q9CZW6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4QPL 1.9 Å, Crystal structure of RNF146(RING-WWE)/UbcH5a/iso-ADPr complex
2RSF Complex structure of WWE in RNF146 with ATP

Browse structure collections

About this viewer

MolViewer shows 1UJR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.