4QPL: RNF146(RING-WWE)/UbcH5a/iso-ADPr complex

Name: PDB 4QPL: Crystal structure of RNF146(RING-WWE)/UbcH5a/iso-ADPr complex
Published: 2014-10-15
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ligase

Crystal structure of RNF146(RING-WWE)/UbcH5a/iso-ADPr complex. Determined by X-ray diffraction at 1.9 Å resolution. Released 15 Oct 2014.

Method: X-ray diffraction
Resolution: 1.9 Å
Organisms: Mus musculus, Homo sapiens
Chains: 4
Atoms: 5,333
Mol. weight: 72.14 kDa
Ligands: V3L, ZN
Released: 15 Oct 2014

Explore 4QPL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4QPL contains 31 α-helices and 44 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	33-34	2
β-strand	35	1	1
α-helix	36	1
β-strand	42	1	1
β-strand	46-48	3	2
β-strand	54-56	3	2
α-helix	57-64	8
α-helix	75-78	4
β-strand	87	1	2
α-helix	90-96	7
β-strand	103-109	7	3
β-strand	112-115	4	3
α-helix	116-117	2
α-helix	118-129	12
β-strand	134-139	6	4
β-strand	142-147	6	4
β-strand	152-155	4	4
β-strand	162-164	3	4
β-strand	165-169	5	3
β-strand	176-177	2	3
β-strand	180-181	2	3

Chains B and D: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	0-15	16
α-helix	17-18	2
β-strand	21-26	6	5
β-strand	29-38	10	5
α-helix	39-40	2
β-strand	49-55	7	5
α-helix	64-65	2
β-strand	66-69	4	5
β-strand	75	1	6
β-strand	78	1	6
β-strand	83	1	5
β-strand	84	1	6
α-helix	87-89	3
α-helix	99-111	13
α-helix	121-129	9
α-helix	131-146	16

Chain C: 8 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	34	1
β-strand	35	1	7
α-helix	36	1
β-strand	42	1	7
α-helix	43	1
β-strand	46-48	3	8
β-strand	54-56	3	8
α-helix	57-64	8
α-helix	75-78	4
β-strand	87	1	8
α-helix	90-98	9
β-strand	103-109	7	9
β-strand	112-115	4	9
α-helix	116-117	2
α-helix	118-129	12
β-strand	134-139	6	10
β-strand	142-147	6	10
β-strand	152-155	4	10
β-strand	163-164	2	10
β-strand	165-169	5	9
β-strand	176-177	2	9
β-strand	180-181	2	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase RNF146	A, C	protein	155	Mus musculus	Q9CZW6 (AlphaFold model)
Ubiquitin-conjugating enzyme E2 D1	B, D	protein	154	Homo sapiens	P51668 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>4QPL_1 E3 ubiquitin-protein ligase RNF146 (chains A, C)
GSLTVPECAICLQTCVHPVSLPCKHVFCYLCVKGASWLGKRCALCRQEIPEDFLDKPTLL
SPEELKAASRGNGEYAWYYEGRNGWWQYDERTSRELEDAFSKGKKNTEMLIAGFLYVADL
ENMVQYRRNEHGRRRKIKRDIIDIPKKGVAGLRLD

Sequence of entity 2 (B, D), FASTA

>4QPL_2 Ubiquitin-conjugating enzyme E2 D1 (chains B, D)
HHHHHHAMALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLT
VHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDP
NPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM

Ligands and cofactors

ID	Name	Formula	Copies
V3L	2'-O-(5-O-phosphono-alpha-D-ribofuranosyl)adenosine 5'-(dihydrogen phosphate)	C15 H23 N5 O14 P2	2
ZN	Zinc ion	Zn	4

Primary citation

Allosteric activation of the RNF146 ubiquitin ligase by a poly(ADP-ribosyl)ation signal. DaRosa, P.A., Wang, Z., Jiang, X. et al. Nature (2015) 517:223-226. DOI 10.1038/nature13826 · PubMed

Other PDB entries of the same protein (UniProt Q9CZW6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1UJR Solution structure of WWE domain in BAB28015
2RSF Complex structure of WWE in RNF146 with ATP

Browse structure collections

About this viewer

MolViewer shows 4QPL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.