Complex structure of WWE in RNF146 with ATP. Determined by solution NMR. Released 6 Mar 2013.
Explore 2RSF in 3D Show helices and sheets RCSB PDB PDBe
2RSF contains 6 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-6 | 3 | |
| α-helix | 10-12 | 3 | |
| α-helix | 17-25 | 9 | |
| β-strand | 31-35 | 5 | 1 |
| β-strand | 40-42 | 3 | 1 |
| α-helix | 43-44 | 2 | |
| α-helix | 45-57 | 13 | |
| β-strand | 61-65 | 5 | 2 |
| β-strand | 70-74 | 5 | 2 |
| β-strand | 79-82 | 4 | 2 |
| β-strand | 90-91 | 2 | 2 |
| β-strand | 92-95 | 4 | 1 |
| α-helix | 101-103 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| E3 ubiquitin-protein ligase RNF146 | A | protein | 110 | Mus musculus | Q9CZW6 (AlphaFold model) |
>2RSF_1 E3 ubiquitin-protein ligase RNF146 (chains A) PSSGSSGFLDKPTLLSPEELKAASRGNGEYAWYYEGRNGWWQYDERTSRELEDAFSKGKK NTEMLIAGFLYVADLENMVQYRRNEHGRRRKIKRDIIDIPKKGVSGPSSG
| ID | Name | Formula | Copies |
|---|---|---|---|
| ATP | Adenosine-5'-triphosphate | C10 H16 N5 O13 P3 | 1 |
Complex structure of WWE domain in RNF146 with ATP. He, F., Inoue, M., Kigawa, T. et al. To be published.
Other PDB entries of the same protein (UniProt Q9CZW6 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2RSF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.