Crystal structure of the human Liver X receptor beta ligand binding domain in complex with a synthetic agonist. Determined by X-ray diffraction at 2.1 Å resolution. Released 20 Oct 2004.
Explore 1UPV in 3D Show helices and sheets RCSB PDB PDBe
1UPV contains 11 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 222-236 | 15 | |
| α-helix | 250-252 | 3 | |
| α-helix | 261-286 | 26 | |
| α-helix | 292-294 | 3 | |
| α-helix | 297-319 | 23 | |
| β-strand | 321 | 1 | 1 |
| β-strand | 326 | 1 | 1 |
| β-strand | 327-328 | 2 | 2 |
| β-strand | 334-335 | 2 | 2 |
| α-helix | 337-341 | 5 | |
| α-helix | 347-363 | 17 | |
| α-helix | 367-378 | 12 | |
| α-helix | 389-410 | 22 | |
| α-helix | 417-444 | 28 | |
| α-helix | 451-457 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Oxysterols receptor lxr-beta | A | protein | 257 | HOMO SAPIENS | P55055 (AlphaFold model) |
>1UPV_1 OXYSTEROLS RECEPTOR LXR-BETA (chains A) GSHMSQGSGEGEGVQLTAAQELMIQQLVAAQLQCNKRSFSDQPKVTPWPLGADPQSRDAR QQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQIALLKASTIEIMLLETARRYNHET ECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMRRLGLDDAEYALLIAINIFSADRP NVQEPGRVEALQQPYVEALLSYTRIKRPQDQLRFPRMLMKLVSLRTLSSVHSEQVFALRL QDKKLPPLLSEIWDVHE
| ID | Name | Formula | Copies |
|---|---|---|---|
| 444 | N-(2,2,2-trifluoroethyl)-N-{4-[2,2,2-trifluoro-1-hydroxy-1-(trifluoromethyl)eth… | C17 H12 F9 N O3 S | 1 |
Crystal Structure of the Human Liver X Receptor Beta Ligand-Binding Domain in Complex with a Synthetic Agonist. Hoerer, S., Schmid, A., Heckel, A. et al. J Mol Biol (2003) 334:853. DOI 10.1016/J.JMB.2003.10.033 · PubMed
Other PDB entries of the same protein (UniProt P55055 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1UPV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.