1UPW: Oxysterols receptor lxr-beta

Name: PDB 1UPW: Crystal structure of the human Liver X receptor beta ligand binding domain in complex with a synthetic agonist
Published: 2004-10-20
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: receptor

Crystal structure of the human Liver X receptor beta ligand binding domain in complex with a synthetic agonist. Determined by X-ray diffraction at 2.4 Å resolution. Released 20 Oct 2004.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 1,906
Mol. weight: 29.9 kDa
Ligands: 444
Released: 20 Oct 2004

Explore 1UPW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1UPW contains 13 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	222-236	15
α-helix	250-252	3
α-helix	261-286	26
α-helix	292-294	3
α-helix	297-318	22
β-strand	321	1	1
β-strand	326	1	1
β-strand	327-328	2	2
β-strand	334-335	2	2
α-helix	337-342	6
α-helix	347-360	14
α-helix	361-363	3
α-helix	367-378	12
α-helix	389-410	22
α-helix	417-444	28
α-helix	448-450	3
α-helix	451-457	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Oxysterols receptor lxr-beta	A	protein	257	HOMO SAPIENS	P55055 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1UPW_1 OXYSTEROLS RECEPTOR LXR-BETA (chains A)
GSHMSQGSGEGEGVQLTAAQELMIQQLVAAQLQCNKRSFSDQPKVTPWPLGADPQSRDAR
QQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQIALLKASTIEIMLLETARRYNHET
ECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMRRLGLDDAEYALLIAINIFSADRP
NVQEPGRVEALQQPYVEALLSYTRIKRPQDQLRFPRMLMKLVSLRTLSSVHSEQVFALRL
QDKKLPPLLSEIWDVHE

Ligands and cofactors

ID	Name	Formula	Copies
444	N-(2,2,2-trifluoroethyl)-N-{4-[2,2,2-trifluoro-1-hydroxy-1-(trifluoromethyl)eth…	C17 H12 F9 N O3 S	1

Primary citation

Crystal Structure of the Human Liver X Receptor Beta Ligand-Binding Domain in Complex with a Synthetic Agonist. Hoerer, S., Schmid, A., Heckel, A. et al. J Mol Biol (2003) 334:853. DOI 10.1016/J.JMB.2003.10.033 · PubMed

Other PDB entries of the same protein (UniProt P55055 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6S5K 1.6 Å, LXRbeta ligand binding domain in complex with small molecule inhibitors
6S4N 1.9 Å, LXRbeta ligand binding domain in comlpex with small molecule inhibitors
6S4T 2.0 Å, LXRbeta ligand binding domain in comlpex with small molecule inhibitors
4RAK 2.04 Å, Crystal structure of nuclear receptor subfamily 1, group h, member 2 (lxrb) complexed…
1PQ9 2.1 Å, Human lxr beta hormone receptor complexed with T0901317 complex
1UPV 2.1 Å, Crystal structure of the human Liver X receptor beta ligand binding domain in complex…
3L0E 2.3 Å, X-ray crystal structure of a Potent Liver X Receptor Modulator
1PQ6 2.4 Å, Human lxr beta hormone receptor / GW3965 complex
3KFC 2.4 Å, Complex Structure of LXR with an agonist
5JY3 2.4 Å, Crystal structure of lxrbeta (nuclear receptor subfamily 1, group H, member 2) complexed…
4DK7 2.45 Å, Crystal structure of LXR ligand binding domain in complex with full agonist 1
6K9H 2.5 Å, Human LXR-beta in complex with an agonist

Browse structure collections

About this viewer

MolViewer shows 1UPW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.