4RAK: Nuclear receptor subfamily 1, group h, member 2

Crystal structure of nuclear receptor subfamily 1, group h, member 2 (lxrb) complexed with partial agonist. Determined by X-ray diffraction at 2.04 Å resolution. Released 31 Dec 2014.

Method: X-ray diffraction
Resolution: 2.04 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,115
Mol. weight: 62.37 kDa
Ligands: 652, BU1
Released: 31 Dec 2014

Explore 4RAK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4RAK contains 26 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	222-242	21
α-helix	243-245	3
α-helix	250-253	4
α-helix	261-287	27
α-helix	292-294	3
α-helix	297-318	22
β-strand	320-321	2	1
β-strand	326-329	4	1
β-strand	333-335	3	1
α-helix	337-341	5
α-helix	350-361	12
α-helix	367-378	12
α-helix	389-410	22
α-helix	417-435	19
α-helix	451-456	6

Chain B: 14 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	222-241	20
α-helix	243-245	3
α-helix	250-252	3
α-helix	263-287	25
α-helix	292-294	3
α-helix	297-318	22
β-strand	320-321	2	2
β-strand	326-329	4	2
β-strand	333-336	4	2
α-helix	337-341	5
α-helix	347-363	17
α-helix	367-378	12
α-helix	389-410	22
α-helix	417-438	22
α-helix	440-442	3
α-helix	448-450	3
α-helix	451-457	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Oxysterols receptor LXR-beta	A, B	protein	264	Homo sapiens	P55055 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4RAK_1 Oxysterols receptor LXR-beta (chains A, B)
MHHHHHHGENLYFQGSEGEGVQLTAAQELMIQQLVAAQLQCNKRSFSDQPKVTPWPLGAD
PQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQIALLKASTIEIMLLETA
RRYNHETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMRRLGLDDAEYALLIAIN
IFSADRPNVQEPGRVEALQQPYVEALLSYTRIKRPQDQLRFPRMLMKLVSLRTLSSVHSE
QVFALRLQDKKLPPLLSEIWDVHE

Ligands and cofactors

ID	Name	Formula	Copies
652	2-{2-[2-(2-chlorophenyl)propan-2-yl]-1-[3'-(methylsulfonyl)biphenyl-4-yl]-1H-im…	C28 H29 Cl N2 O3 S	2
BU1	1,4-butanediol	C4 H10 O2	3

Primary citation

Liver X Receptor (LXR) partial agonists: Biaryl pyrazoles and imidazoles displaying a preference for LXR beta. Kick, E., Martin, R., Xie, Y. et al. Bioorg Med Chem Lett (2015) 25:372-377. DOI 10.1016/j.bmcl.2014.11.029 · PubMed

Other PDB entries of the same protein (UniProt P55055 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6S5K 1.6 Å, LXRbeta ligand binding domain in complex with small molecule inhibitors
6S4N 1.9 Å, LXRbeta ligand binding domain in comlpex with small molecule inhibitors
6S4T 2.0 Å, LXRbeta ligand binding domain in comlpex with small molecule inhibitors
1PQ9 2.1 Å, Human lxr beta hormone receptor complexed with T0901317 complex
1UPV 2.1 Å, Crystal structure of the human Liver X receptor beta ligand binding domain in complex…
3L0E 2.3 Å, X-ray crystal structure of a Potent Liver X Receptor Modulator
1PQ6 2.4 Å, Human lxr beta hormone receptor / GW3965 complex
1UPW 2.4 Å, Crystal structure of the human Liver X receptor beta ligand binding domain in complex…
3KFC 2.4 Å, Complex Structure of LXR with an agonist
5JY3 2.4 Å, Crystal structure of lxrbeta (nuclear receptor subfamily 1, group H, member 2) complexed…
4DK7 2.45 Å, Crystal structure of LXR ligand binding domain in complex with full agonist 1
6K9H 2.5 Å, Human LXR-beta in complex with an agonist

Browse structure collections

About this viewer

MolViewer shows 4RAK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.