Hyaluronan binding domain of human CD44. Determined by X-ray diffraction at 2.2 Å resolution. Released 4 Mar 2004.
Explore 1UUH in 3D Show helices and sheets RCSB PDB PDBe
1UUH contains 15 α-helices and 31 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 21-26 | 6 | 1 |
| α-helix | 27-28 | 2 | |
| β-strand | 29-30 | 2 | 1 |
| β-strand | 33-38 | 6 | 1 |
| β-strand | 41 | 1 | 1 |
| β-strand | 44 | 1 | 2 |
| α-helix | 46-55 | 10 | |
| β-strand | 59 | 1 | 1 |
| α-helix | 60-62 | 3 | |
| α-helix | 63-70 | 8 | |
| β-strand | 80-82 | 3 | 1 |
| β-strand | 85-90 | 6 | 1 |
| β-strand | 94 | 1 | 3 |
| β-strand | 97 | 1 | 3 |
| α-helix | 98-100 | 3 | |
| β-strand | 103-106 | 4 | 1 |
| α-helix | 107 | 1 | |
| β-strand | 114 | 1 | 2 |
| β-strand | 115-119 | 5 | 1 |
| β-strand | 127-128 | 2 | 1 |
| β-strand | 139-148 | 10 | 1 |
| β-strand | 154-160 | 7 | 1 |
| α-helix | 165-168 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 21-26 | 6 | 4 |
| α-helix | 27-28 | 2 | |
| β-strand | 29-30 | 2 | 4 |
| β-strand | 33-38 | 6 | 4 |
| β-strand | 44 | 1 | 5 |
| α-helix | 46-55 | 10 | |
| β-strand | 59 | 1 | 4 |
| α-helix | 60-62 | 3 | |
| α-helix | 63-71 | 9 | |
| β-strand | 80-82 | 3 | 4 |
| β-strand | 85-90 | 6 | 4 |
| β-strand | 94 | 1 | 6 |
| β-strand | 97 | 1 | 6 |
| α-helix | 98-100 | 3 | |
| β-strand | 103-106 | 4 | 4 |
| α-helix | 107 | 1 | |
| β-strand | 114 | 1 | 5 |
| β-strand | 115-119 | 5 | 4 |
| β-strand | 127-128 | 2 | 4 |
| α-helix | 130-132 | 3 | |
| β-strand | 139-148 | 10 | 4 |
| β-strand | 154-160 | 7 | 4 |
| α-helix | 165-168 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| CD44 antigen | A, B | protein | 159 | HOMO SAPIENS | P16070 (AlphaFold model) |
>1UUH_1 CD44 ANTIGEN (chains A, B) AQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRY GFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAF DGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDV
Structure of the Regulatory Hyaluronan-Binding Domain in the Inflammatory Leukocyte Homing Receptor Cd44. Teriete, P., Banerji, S., Noble, M. et al. Mol Cell (2004) 13:483. DOI 10.1016/S1097-2765(04)00080-2 · PubMed
Other PDB entries of the same protein (UniProt P16070 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1UUH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.