1UUH: Hyaluronan binding domain of human CD44

Hyaluronan binding domain of human CD44. Determined by X-ray diffraction at 2.2 Å resolution. Released 4 Mar 2004.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 2,596
Mol. weight: 35.39 kDa
Released: 4 Mar 2004

Explore 1UUH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1UUH contains 15 α-helices and 31 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	21-26	6	1
α-helix	27-28	2
β-strand	29-30	2	1
β-strand	33-38	6	1
β-strand	41	1	1
β-strand	44	1	2
α-helix	46-55	10
β-strand	59	1	1
α-helix	60-62	3
α-helix	63-70	8
β-strand	80-82	3	1
β-strand	85-90	6	1
β-strand	94	1	3
β-strand	97	1	3
α-helix	98-100	3
β-strand	103-106	4	1
α-helix	107	1
β-strand	114	1	2
β-strand	115-119	5	1
β-strand	127-128	2	1
β-strand	139-148	10	1
β-strand	154-160	7	1
α-helix	165-168	4

Chain B: 8 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	21-26	6	4
α-helix	27-28	2
β-strand	29-30	2	4
β-strand	33-38	6	4
β-strand	44	1	5
α-helix	46-55	10
β-strand	59	1	4
α-helix	60-62	3
α-helix	63-71	9
β-strand	80-82	3	4
β-strand	85-90	6	4
β-strand	94	1	6
β-strand	97	1	6
α-helix	98-100	3
β-strand	103-106	4	4
α-helix	107	1
β-strand	114	1	5
β-strand	115-119	5	4
β-strand	127-128	2	4
α-helix	130-132	3
β-strand	139-148	10	4
β-strand	154-160	7	4
α-helix	165-168	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CD44 antigen	A, B	protein	159	HOMO SAPIENS	P16070 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1UUH_1 CD44 ANTIGEN (chains A, B)
AQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRY
GFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAF
DGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDV

Primary citation

Structure of the Regulatory Hyaluronan-Binding Domain in the Inflammatory Leukocyte Homing Receptor Cd44. Teriete, P., Banerji, S., Noble, M. et al. Mol Cell (2004) 13:483. DOI 10.1016/S1097-2765(04)00080-2 · PubMed

Other PDB entries of the same protein (UniProt P16070 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4PZ3 1.08 Å, High-resolution crystal structure of the human CD44 hyaluronan binding domain complex…
4PZ4 1.6 Å, High-resolution crystal structure of the human CD44 hyaluronan binding domain in new…
32NZ 1.8 Å, An activating H90 ScFv bound to the hyaluronan-binding domain of human CD44
6TXS 2.2 Å, The structure of the FERM domain and helical linker of human moesin bound to a CD44…
1POZ Solution structure of the hyaluronan binding domain of human CD44
2I83 hyaluronan-binding domain of CD44 in its ligand-bound form

Browse structure collections

About this viewer

MolViewer shows 1UUH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.