32NZ: An activating H90 ScFv

An activating H90 ScFv bound to the hyaluronan-binding domain of human CD44. Determined by X-ray diffraction at 1.8 Å resolution. Released 12 Aug 2026.

Method: X-ray diffraction
Resolution: 1.8 Å
Organisms: synthetic construct, Homo sapiens
Chains: 2
Atoms: 3,129
Mol. weight: 44.47 kDa
Released: 12 Aug 2026

Explore 32NZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

32NZ contains 16 α-helices and 39 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	1
α-helix	7-9	3
β-strand	10-12	3	2
β-strand	18-25	8	1
α-helix	29-31	3
α-helix	33	1
β-strand	34-39	6	2
β-strand	45-52	8	2
β-strand	57-60	4	2
α-helix	62-64	3
β-strand	65	1	1
β-strand	68-73	6	1
β-strand	78-83	6	1
α-helix	88-90	3
β-strand	92-99	8	2
α-helix	100	1
β-strand	107-110	4	2
β-strand	114-118	5	2
α-helix	162-164	3
β-strand	165-168	4	3
β-strand	171-175	5	4
β-strand	180-186	7	3
β-strand	191	1	5
β-strand	197	1	5
β-strand	199-204	6	4
β-strand	211-215	5	4
β-strand	219-220	2	4
α-helix	221	1
β-strand	228-233	6	3
β-strand	236-241	6	3
α-helix	246-248	3
β-strand	250-256	7	4
β-strand	263-264	2	4
β-strand	268-273	6	4
α-helix	274-275	2

Chain B: 6 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	22-27	6	6
α-helix	28	1
β-strand	29-30	2	6
β-strand	33-38	6	6
β-strand	44	1	7
α-helix	46-55	10
β-strand	59	1	6
α-helix	60-62	3
α-helix	63-71	9
β-strand	80-82	3	6
β-strand	85-90	6	6
β-strand	94	1	8
β-strand	97	1	8
β-strand	103-106	4	6
α-helix	107	1
β-strand	114	1	7
β-strand	115-119	5	6
β-strand	127-128	2	6
α-helix	136-138	3
β-strand	143-148	6	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
H90 scFv	A	protein	278	synthetic construct
CD44 antigen	B	protein	134	Homo sapiens	P16070 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>32NZ_1 H90 scFv (chains A)
QVQLQQSGDELVRPGSSVKISCKASGYAFSRYWMNWVKQRPGQGLEWIGQIYPGDGDTNY
NGKFKGKATLTADKSSSTAYMQLNSLTSEDSAVYFCARRRWSDYFGMDYWGQGTSVTVSS
AKTTPPSVYPLAPGSTAQTNSMVTLGGGGGSGGGGSGGGGSDVVMTQTPLTLSVTIGQPA
SISCKSSQSLLHSNGKTYLNWLLQRPGQSPKLLIYLVSKLESGVPDRFSGSGSGTEFTLK
ISRVEAEDSGVYYCLQATHFPLTFGAGTKLELKRTDYK

Sequence of entity 2 (B), FASTA

>32NZ_2 CD44 antigen (chains B)
MAMAQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFET
CRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLP
NAFDGPITITIVNR

Primary citation

An activating H90 ScFv bound to the hyaluronan-binding domain of human CD44. Bradshaw, W.J., Wilkes, A.J.R., Katis, V.L. et al. To be published.

Other PDB entries of the same protein (UniProt P16070 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4PZ3 1.08 Å, High-resolution crystal structure of the human CD44 hyaluronan binding domain complex…
4PZ4 1.6 Å, High-resolution crystal structure of the human CD44 hyaluronan binding domain in new…
1UUH 2.2 Å, Hyaluronan binding domain of human CD44
6TXS 2.2 Å, The structure of the FERM domain and helical linker of human moesin bound to a CD44…
1POZ Solution structure of the hyaluronan binding domain of human CD44
2I83 hyaluronan-binding domain of CD44 in its ligand-bound form

Browse structure collections

About this viewer

MolViewer shows 32NZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.