2I83: CD44 antigen

hyaluronan-binding domain of CD44 in its ligand-bound form. Determined by solution NMR. Released 21 Nov 2006.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,228
Mol. weight: 17.73 kDa
Released: 21 Nov 2006

Explore 2I83 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2I83 contains 4 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	22-26	5	1
β-strand	29	1	2
β-strand	30	1	1
β-strand	33-38	6	1
β-strand	44	1	3
α-helix	46-54	9
β-strand	59	1	1
α-helix	63-69	7
β-strand	87-90	4	4
α-helix	98-100	3
β-strand	103-106	4	4
β-strand	114	1	3
β-strand	116-119	4	1
β-strand	128	1	2
β-strand	143-147	5	1
α-helix	163-165	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CD44 antigen	A	protein	160	Homo sapiens	P16070 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2I83_1 CD44 antigen (chains A)
MAQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCR
YGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNA
FDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDV

Primary citation

Ligand-induced Structural Changes of the CD44 Hyaluronan-binding Domain Revealed by NMR. Takeda, M., Ogino, S., Umemoto, R. et al. J Biol Chem (2006) 281:40089-40095. DOI 10.1074/jbc.M608425200 · PubMed

Other PDB entries of the same protein (UniProt P16070 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4PZ3 1.08 Å, High-resolution crystal structure of the human CD44 hyaluronan binding domain complex…
4PZ4 1.6 Å, High-resolution crystal structure of the human CD44 hyaluronan binding domain in new…
32NZ 1.8 Å, An activating H90 ScFv bound to the hyaluronan-binding domain of human CD44
1UUH 2.2 Å, Hyaluronan binding domain of human CD44
6TXS 2.2 Å, The structure of the FERM domain and helical linker of human moesin bound to a CD44…
1POZ Solution structure of the hyaluronan binding domain of human CD44

Browse structure collections

About this viewer

MolViewer shows 2I83 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.