1UW6: Acetylcholine binding protein

X-ray structure of acetylcholine binding protein (AChBP) in complex with nicotine. Determined by X-ray diffraction at 2.2 Å resolution. Released 25 Mar 2004.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: LYMNAEA STAGNALIS
Chains: 20
Atoms: 34,788
Mol. weight: 483.76 kDa
Ligands: NCT
Released: 25 Mar 2004

Explore 1UW6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1UW6 contains 81 α-helices and 282 β-strands across 20 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	3-13	11
β-strand	27-42	16	1
β-strand	47-59	13	1
α-helix	61-63	3
β-strand	73-77	5	1
α-helix	78-80	3
β-strand	86-88	3	2
β-strand	91	1	1
β-strand	96-97	2	1
β-strand	102-106	5	1
β-strand	110-113	4	1
β-strand	116-122	7	1
β-strand	134-142	9	2
β-strand	150-154	5	1
β-strand	171-184	14	2
β-strand	191-203	13	2
α-helix	204-205	2

Chain B: 3 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	3-13	11
β-strand	27-42	16	3
β-strand	47-59	13	3
α-helix	61-63	3
β-strand	73-77	5	3
α-helix	78-80	3
β-strand	86-88	3	4
β-strand	91	1	3
β-strand	96-97	2	3
β-strand	102-106	5	3
β-strand	110-113	4	3
β-strand	116-122	7	3
β-strand	134-142	9	4
β-strand	150-154	5	3
β-strand	171-185	15	4
β-strand	188-203	16	4

Chains C and J: 4 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	3-12	10
β-strand	22	1	5
β-strand	25	1	5
α-helix	26	1
β-strand	27-42	16	6
β-strand	47-59	13	6
α-helix	61-63	3
β-strand	73-77	5	6
α-helix	78-80	3
β-strand	86-88	3	7
β-strand	91	1	6
β-strand	96-97	2	6
β-strand	102-106	5	6
β-strand	110-113	4	6
β-strand	116-122	7	6
β-strand	134-142	9	7
β-strand	150-154	5	6
β-strand	171-184	14	7
β-strand	191-203	13	7

Chain D: 4 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	3-13	11
β-strand	22	1	8
β-strand	25	1	8
β-strand	27-42	16	9
β-strand	47-59	13	9
α-helix	61-63	3
β-strand	73-77	5	9
α-helix	78-80	3
β-strand	86-88	3	10
β-strand	91	1	9
β-strand	96-97	2	9
β-strand	102-106	5	9
β-strand	110-113	4	9
β-strand	116-122	7	9
β-strand	134-142	9	10
β-strand	150-153	4	9
β-strand	171-184	14	10
β-strand	191-203	13	10
α-helix	204-205	2

Chains E and S: 3 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	3-13	11
β-strand	22	1	11
β-strand	25	1	11
β-strand	27-42	16	12
β-strand	47-59	13	12
α-helix	61-63	3
β-strand	73-77	5	12
α-helix	78-80	3
β-strand	86-88	3	13
β-strand	91	1	12
β-strand	96-97	2	12
β-strand	102-106	5	12
β-strand	110-113	4	12
β-strand	116-122	7	12
β-strand	134-142	9	13
β-strand	150-153	4	12
β-strand	171-184	14	13
β-strand	191-203	13	13

Chain F: 5 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	3-12	10
β-strand	22	1	14
β-strand	25	1	14
β-strand	27-42	16	15
β-strand	47-59	13	15
α-helix	61-63	3
β-strand	73-77	5	15
α-helix	78-80	3
β-strand	86-88	3	16
β-strand	91	1	15
β-strand	96-97	2	15
β-strand	102-106	5	15
β-strand	110-113	4	15
β-strand	116-122	7	15
β-strand	134-142	9	16
β-strand	150-154	5	15
α-helix	161-164	4
β-strand	171-184	14	16
β-strand	191-203	13	16
α-helix	204-205	2

Chains G and K: 4 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	3-13	11
β-strand	22	1	17
β-strand	25	1	17
α-helix	26	1
β-strand	27-42	16	18
β-strand	47-59	13	18
α-helix	61-63	3
β-strand	73-77	5	18
α-helix	78-80	3
β-strand	86-88	3	19
β-strand	91	1	18
β-strand	96-97	2	18
β-strand	102-106	5	18
β-strand	110-113	4	18
β-strand	116-122	7	18
β-strand	134-142	9	19
β-strand	150-154	5	18
β-strand	171-184	14	19
β-strand	191-203	13	19

Chain H: 4 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	3-13	11
α-helix	26	1
β-strand	27-42	16	20
β-strand	47-59	13	20
α-helix	61-63	3
β-strand	73-77	5	20
α-helix	78-80	3
β-strand	86-88	3	21
β-strand	91	1	20
β-strand	96-97	2	20
β-strand	102-106	5	20
β-strand	110-113	4	20
β-strand	116-122	7	20
β-strand	134-142	9	21
β-strand	150-154	5	20
β-strand	171-184	14	21
β-strand	191-203	13	21

8 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Acetylcholine-binding protein	A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T	protein	211	LYMNAEA STAGNALIS	P58154 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T), FASTA

>1UW6_1 ACETYLCHOLINE-BINDING PROTEIN (chains A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T)
EFDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWS
DRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQ
RFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQK
KNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL

Ligands and cofactors

ID	Name	Formula	Copies
NCT	(s)-3-(1-methylpyrrolidin-2-yl)pyridine	C10 H14 N2	20

Primary citation

Nicotine and Carbamylcholine Binding to Nicotinic Acetylcholine Receptors as Studied in Achbp Crystal Structures. Celie, P.H.N., Van Rossum-Fikkert, S.E., Van Dijk, W.J. et al. Neuron (2004) 41:907. DOI 10.1016/S0896-6273(04)00115-1 · PubMed

Other PDB entries of the same protein (UniProt P58154 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7NDV 1.7 Å, X-ray structure of acetylcholine-binding protein (AChBP) in complex with FL001888.
4ZK1 1.75 Å, Crystal Structure of Lymnaea stagnalis Acetylcholine-Binding Protein (LsAChBP) in…
4ZJT 1.85 Å, X-ray crystal structure of Lymnaea stagnalis acetylcholine binding protein (LsAChBP) in…
4ZRU 1.9 Å, X-ray crystal structure of Lymnaea stagnalis acetylcholine binding protein (Ls-AChBP) in…
8P11 1.9 Å, X-ray structure of acetylcholine-binding protein (AChBP) in complex with FL003044.
7NDP 2.0 Å, X-ray structure of acetylcholine-binding protein (AChBP) in complex with FL001856.
7PD6 2.0 Å, Crystal structure of Lymnaea stagnalis Acetylcholine-binding protein (Ls-AChBP)…
7PE6 2.01 Å, Crystal structure of Lymnaea stagnalis Acetylcholine-binding protein (Ls-AChBP)…
5J5G 2.04 Å, X-Ray Crystal Structure of Acetylcholine Binding Protein (AChBP) in Complex with…
5J5F 2.04 Å, X-Ray Crystal Structure of Acetylcholine Binding Protein (AChBP) in Complex with…
3WTN 2.09 Å, Crystal Structure of Lymnaea stagnalis Acetylcholine Binding Protein Complexed with…
4QAC 2.1 Å, X-RAY STRUCTURE OF ACETYLCHOLINE BINDING PROTEIN (ACHBP) IN COMPLEX WITH…

Browse structure collections

About this viewer

MolViewer shows 1UW6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.