1UYW: Antiflavivirus Fab4g2

Crystal Structure of the antiflavivirus Fab4g2. Determined by X-ray diffraction at 2.0 Å resolution. Released 10 Mar 2005.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: MUS MUSCULUS
Chains: 4
Atoms: 7,052
Mol. weight: 93.06 kDa
Released: 10 Mar 2005

Explore 1UYW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1UYW contains 34 α-helices and 83 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 8 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	1
β-strand	10-12	3	2
β-strand	18-25	8	1
α-helix	29-31	3
β-strand	34-39	6	2
β-strand	46-51	6	2
β-strand	57-59	3	2
β-strand	67-72	6	1
α-helix	73-75	3
β-strand	77-82	6	1
α-helix	84-86	3
β-strand	88-95	8	2
β-strand	100B-103	4	2
β-strand	107-111	5	2
α-helix	114-116	3
β-strand	117	1	3
α-helix	118-119	2
β-strand	120-124	5	4
α-helix	125-127	3
β-strand	135-145	11	4
β-strand	146	1	3
β-strand	151-154	4	5
α-helix	155-157	3
β-strand	163-171	9	4
β-strand	174-184	11	4
β-strand	194-199	6	5
α-helix	200-202	3
β-strand	204-209	6	5

Chain L: 8 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	6
β-strand	10-14	5	7
β-strand	19-25	7	6
β-strand	33-38	6	7
β-strand	45-49	5	7
β-strand	53-54	2	7
α-helix	55	1
β-strand	62-67	6	6
β-strand	70-75	6	6
α-helix	80-82	3
β-strand	84-90	7	7
α-helix	96	1
β-strand	97-98	2	7
β-strand	102-107	6	7
β-strand	111	1	8
α-helix	112-113	2
β-strand	114-118	5	9
α-helix	119-121	3
α-helix	122-126	5
β-strand	129-139	11	9
β-strand	140	1	8
β-strand	145-150	6	10
β-strand	153-155	3	10
β-strand	159-163	5	9
α-helix	164-167	4
β-strand	173-182	10	9
α-helix	183-188	6
β-strand	191-197	7	10
β-strand	205-210	6	10

Chain M: 10 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	11
α-helix	7-9	3
β-strand	10-12	3	12
β-strand	18-25	8	11
α-helix	29-31	3
β-strand	34-39	6	12
β-strand	46-51	6	12
β-strand	57-59	3	12
α-helix	61-63	3
β-strand	64	1	11
β-strand	67-72	6	11
α-helix	73-75	3
β-strand	77-82	6	11
α-helix	84-86	3
β-strand	88-95	8	12
β-strand	100B-103	4	12
β-strand	107-111	5	12
α-helix	115-116	2
β-strand	117	1	13
α-helix	118-119	2
β-strand	120-124	5	14
α-helix	125-127	3
β-strand	135-145	11	14
β-strand	146	1	13
β-strand	151-154	4	15
α-helix	155-157	3
β-strand	163-171	9	14
β-strand	174-184	11	14
β-strand	194-199	6	15
α-helix	200-202	3
β-strand	204-209	6	15

Chain N: 8 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	16
β-strand	10-14	5	17
β-strand	19-25	7	16
β-strand	33-38	6	17
β-strand	45-49	5	17
β-strand	53-54	2	17
α-helix	55	1
β-strand	62-67	6	16
β-strand	70-75	6	16
α-helix	80-82	3
β-strand	84-90	7	17
α-helix	96	1
β-strand	97-98	2	17
β-strand	102-107	6	17
β-strand	111	1	18
α-helix	112-113	2
β-strand	114-118	5	19
α-helix	119-121	3
α-helix	122-127	6
β-strand	129-139	11	19
β-strand	140	1	18
β-strand	145-150	6	20
β-strand	153-155	3	20
β-strand	159-163	5	19
α-helix	164-167	4
β-strand	173-182	10	19
α-helix	183-188	6
β-strand	191-197	7	20
β-strand	205-210	6	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
FAB antibody heavy chain	H, M	protein	218	MUS MUSCULUS	P01863 (AlphaFold model)
FAB antibody light chain	L, N	protein	212	MUS MUSCULUS	P01634 (AlphaFold model)

Sequence of entity 1 (H, M), FASTA

>1UYW_1 FAB ANTIBODY HEAVY CHAIN (chains H, M)
VQLQQSGPELVKPGTSVKISCKTSGYTFTEYTIHWVKEAGGKSLAWIGGIDPNSGGTNYS
PNFKGKATLTVDKSSSTAYMDLRSLSSEDSAVYFCARIYHYDGYFDVWGAGTAVTVSSAK
TTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLY
TLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR

Sequence of entity 2 (L, N), FASTA

>1UYW_2 FAB ANTIBODY LIGHT CHAIN (chains L, N)
NIVMTQSPKSMSMSVGERVTLTCKASENVVTYVSWYQQKPEQSPKLLIYGASNRYTGVPD
RFTGSGSATDFTLTISSVQAEDLADYHCGQGYSYPYTFGGGTKLELKRADAAPTVSIFPP
SSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLT
LTKDEYERHNSYTCEATHKTSTSPIVKSFNRN

Primary citation

Crystal Structure of the Antiflavivirus Fab4G2. Martinez-Fleites, C., Ortiz-Lombardia, M., Taylor, E.J. et al. To be published.

Other PDB entries of the same protein (UniProt P01863 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5VAA 1.55 Å, Crystal structure of mouse IgG2a Fc T370K mutant
3OZ9 1.6 Å, Crystal Structure of anti-gp41 Fab NC-1
2IPU 1.65 Å, PFA1 Fab fragment complexed with Abeta 1-8 peptide
1DQQ 1.8 Å, Crystal structure of anti-lysozyme antibody hyhel-63
1YEJ 1.85 Å, Catalytic antibody complex
1KN2 1.9 Å, Catalytic antibody D2.3 complex
1KN4 1.9 Å, Catalytic antibody D2.3 complex
1YEC 1.9 Å, Structure of a catalytic antibody IGG2A FAB fragment (D2.3)
1YEI 1.9 Å, Catalytic antibody D2.3 complex
1YEF 2.0 Å, Structure of IGG2A FAB fragment (D2.3) complexed with substrate analogue
1YEG 2.0 Å, Structure of IGG2A FAB fragment (D2.3) complexed with reaction product
1FE8 2.03 Å, Crystal structure of the von willebrand factor A3 domain in complex with a FAB fragment…

Browse structure collections

About this viewer

MolViewer shows 1UYW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.