7AM3: Peptiligase mutant - M222P

Name: PDB 7AM3: Crystal structure of Peptiligase mutant - M222P
Published: 2021-02-17
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ligase

Crystal structure of Peptiligase mutant - M222P. Determined by X-ray diffraction at 1.61 Å resolution. Released 17 Feb 2021.

Method: X-ray diffraction
Resolution: 1.61 Å
Organism: Bacillus amyloliquefaciens
Chains: 1
Atoms: 2,319
Mol. weight: 27.98 kDa
Released: 17 Feb 2021

Explore 7AM3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7AM3 contains 12 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	6-10	5
α-helix	13-19	7
β-strand	27-32	6	1
β-strand	46-49	4	1
α-helix	64-75	12
β-strand	89-94	6	1
α-helix	104-116	13
β-strand	121-124	4	1
β-strand	128	1	2
α-helix	133-144	12
β-strand	148-152	5	1
β-strand	159	1	3
β-strand	162	1	3
α-helix	165-166	2
β-strand	167	1	2
β-strand	175-180	6	1
α-helix	185	1
β-strand	186	1	1
α-helix	187	1
β-strand	198-201	4	1
β-strand	205-209	5	4
β-strand	213-217	5	4
α-helix	220-237	18
α-helix	243-252	10
β-strand	255	1	1
α-helix	260-263	4
β-strand	267	1	1
α-helix	270-273	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Subtilisin BPN'	A	protein	272	Bacillus amyloliquefaciens	P00782 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7AM3_1 Subtilisin BPN' (chains A)
AKCVSYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLNVAGGASFVPSETNPFQD
NNSHGTHVAGTVLAVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANNMDVINMSLGGP
SGSAALKAAVDKAVASGVVVVAAAGNSGTSGSSSTVSYPAKYPSVIAVGAVDSSNQRAPF
SSVGPELDVMAPGVSICSTLPGNKYGALSGTCPASAHVAGAAALILSKHPNWTNTQVRSS
LENTATKLGDSFYYGKGLINVEAAAQHHHHHH

Primary citation

From thiol-subtilisin to omniligase: Design and structure of a broadly applicable peptide ligase. Toplak, A., Teixeira de Oliveira, E.F., Schmidt, M. et al. Comput Struct Biotechnol J (2021) 19:1277-1287. DOI 10.1016/j.csbj.2021.02.002 · PubMed

Other PDB entries of the same protein (UniProt P00782 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1TO2 1.3 Å, crystal structure of the complex of subtilisin BPN' with chymotrypsin inhibitor 2 M59K,…
1TM5 1.45 Å, crystal structure of the complex of subtilisin BPN' with chymotrypsin inhibitor 2 M59A…
1LW6 1.5 Å, Crystal Structure of the Complex of Subtilisin BPN' with Chymotrypsin Inhibitor 2 at 1.5…
1V5I 1.5 Å, Crystal structure of serine protease inhibitor POIA1 in complex with subtilisin BPN'
1Y34 1.55 Å, Crystal structure of the complex of subtilisin BPN' with chymotrypsin inhibitor 2 E60A…
8H7O 1.55 Å, Crystal structure of aqualigase
1Y1K 1.56 Å, Crystal structure of the complex of subtilisin BPN' with chymotrypsin inhibitor 2 T58A…
1TM3 1.57 Å, crystal structure of the complex of subtilisin BPN' with chymotrypsin inhibitor 2 M59k…
1TM7 1.59 Å, crystal structure of the complex of subtilisin BPN' with chymotrypsin inhibitor 2 M59Y…
1SUP 1.6 Å, Subtilisin bpn' at 1.6 Å resolution: analysis of discrete disorder and comparison of…
1Y4A 1.6 Å, Crystal structure of the complex of subtilisin BPN' with chymotrypsin inhibitor 2…
1TMG 1.67 Å, crystal structure of the complex of subtilisin BPN' with chymotrypsin inhibitor 2 M59F…

Browse structure collections

About this viewer

MolViewer shows 7AM3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.