1VD2: PB1 domain of PKCiota

Solution Structure of the PB1 domain of PKCiota. Determined by solution NMR. Released 14 Sept 2004.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 722
Mol. weight: 10.32 kDa
Released: 14 Sept 2004

Explore 1VD2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1VD2 contains 2 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	17-22	6	1
β-strand	27-32	6	1
α-helix	38-48	11
β-strand	57-61	5	2
β-strand	69-70	2	2
α-helix	74-86	13
β-strand	92-93	2	1
β-strand	94-98	5	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein kinase C, iota type	A	protein	89	Homo sapiens	P41743 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1VD2_1 Protein kinase C, iota type (chains A)
GPLGSQVRVKAYYRGDIMITHFEPSISFEGLCNEVRDMCSFDNEQLFTMKWIDEEGDPCT
VSSQLELEEAFRLYELNKDSELLIHVFPC

Primary citation

Solution structure of atypical protein kinase C PB1 domain and its mode of interaction with ZIP/p62 and MEK5. Hirano, Y., Yoshinaga, S., Ogura, K. et al. J Biol Chem (2004) 279:31883-31890. DOI 10.1074/jbc.M403092200 · PubMed

Other PDB entries of the same protein (UniProt P41743 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1WMH 1.5 Å, Crystal structure of a PB1 domain complex of Protein kinase c iota and Par6 alpha
5LI9 1.79 Å, Structure of a nucleotide-bound form of PKCiota core kinase domain
3A8X 2.0 Å, Crystal Structure of PKCiota kinase domain
5LI1 2.0 Å, Structure of a Par3-inhibitory peptide bound to PKCiota core kinase domain
3A8W 2.1 Å, Crystal Structure of PKCiota kinase domain
8R3X 2.59 Å, Crystal structure of aPKC Iota kinase domain with LLGL2 peptide
3ZH8 2.74 Å, A novel small molecule aPKC inhibitor
1ZRZ 3.0 Å, Crystal Structure of the Catalytic Domain of Atypical Protein Kinase C-iota
9EJK 3.08 Å, Lgl2 bound to the aPKCiota-Par6b complex in nucleotide-free form. Head sub-complex…
5LIH 3.25 Å, Structure of a peptide-substrate bound to PKCiota core kinase domain
6ILZ 3.26 Å, Crystal structure of PKCiota in complex with inhibitor
9EJM 3.33 Å, Lgl2 bound to the aPKCiota-Par6B complex in its ADP-bound form

Browse structure collections

About this viewer

MolViewer shows 1VD2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.