Structure of viral interleukin-10. Determined by X-ray diffraction at 1.9 Å resolution. Released 1 Apr 1997.
Explore 1VLK in 3D Show helices and sheets RCSB PDB PDBe
1VLK contains 10 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 21-34 | 14 | |
| α-helix | 50-57 | 8 | |
| α-helix | 61-71 | 11 | |
| α-helix | 72-76 | 5 | |
| α-helix | 77-83 | 7 | |
| α-helix | 88-107 | 20 | |
| α-helix | 113-115 | 3 | |
| α-helix | 119-130 | 12 | |
| α-helix | 132-141 | 10 | |
| α-helix | 143-155 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Viral interleukin-10 | A | protein | 145 | Human herpesvirus 4 | P03180 (AlphaFold model) |
>1VLK_1 VIRAL INTERLEUKIN-10 (chains A) QCDNFPQMLRDLRDAFSRVKTFFQTKDEVDNLLLKESLLEDFKGYLGCQALSEMIQFYLE EVMPQAENQDPEAKDHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQIKNAFNKLQEK GIYKAMSEFDIFINYIEAYMTIKAR
Crystal structure of Epstein-Barr virus protein BCRF1, a homolog of cellular interleukin-10. Zdanov, A., Schalk-Hihi, C., Menon, S. et al. J Mol Biol (1997) 268:460-467. DOI 10.1006/jmbi.1997.0990 · PubMed
Other PDB entries of the same protein (UniProt P03180 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1VLK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.