1Y6N: Epstein-Barr virus IL-10 mutant

Crystal structure of Epstein-Barr virus IL-10 mutant (A87I) complexed with the soluble IL-10R1 chain. Determined by X-ray diffraction at 2.7 Å resolution. Released 3 May 2005.

Method: X-ray diffraction
Resolution: 2.7 Å
Organisms: Human herpesvirus 4, Homo sapiens
Chains: 2
Atoms: 2,846
Mol. weight: 41.95 kDa
Released: 3 May 2005

Explore 1Y6N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1Y6N contains 20 α-helices and 19 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain L: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	19-31	13
α-helix	34-37	4
α-helix	50-57	8
α-helix	61-70	10
α-helix	71-76	6
α-helix	77-81	5
α-helix	85-87	3
α-helix	88-106	19
α-helix	113-115	3
α-helix	119-129	11
α-helix	132-141	10
α-helix	143-155	13

Chain R: 8 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	5-8	4
β-strand	11-16	6	1
β-strand	19-24	6	1
α-helix	25-27	3
β-strand	35-42	8	2
β-strand	49-55	7	2
β-strand	59-61	3	1
α-helix	63-65	3
α-helix	69-71	3
β-strand	75-83	9	2
β-strand	86-87	2	2
β-strand	91-92	2	2
β-strand	97	1	2
α-helix	99-101	3
β-strand	102	1	1
α-helix	103	1
β-strand	104	1	3
β-strand	108-113	6	4
β-strand	117-123	7	4
α-helix	136-139	4
β-strand	144-153	10	5
β-strand	160-164	5	5
β-strand	168-172	5	4
β-strand	179-188	10	5
β-strand	195	1	3
α-helix	196-199	4
β-strand	201-202	2	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Viral interleukin-10 homolog	L	protein	145	Human herpesvirus 4	P03180 (AlphaFold model)
Interleukin-10 receptor alpha chain	R	protein	214	Homo sapiens	Q13651 (AlphaFold model)

Sequence of entity 1 (L), FASTA

>1Y6N_1 Viral interleukin-10 homolog (chains L)
QCDNFPQMLRDLRDAFSRVKTFFQTKDEVDNLLLKESLLEDFKGYLGCQALSEMIQFYLE
EVMPQAENQDPEIKDHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQIKNAFNKLQEK
GIYKAMSEFDIFINYIEAYMTIKAR

Sequence of entity 2 (R), FASTA

>1Y6N_2 Interleukin-10 receptor alpha chain (chains R)
HGTELPSPPSVWFEAEFFHHILHWTPIPQQSESTCYEVALLRYGIESWNSISQCSQTLSY
DLTAVTLDLYHSNGYRARVRAVDGSRHSQWTVTNTRFSVDEVTLTVGSVNLEIHNGFILG
KIQLPRPKMAPAQDTYESIFSHFREYEIAIRKVPGQFTFTHKKVKHEQFSLLTSGEVGEF
CVQVKPSVASRSNKGMWSKEECISLTRQYFTVTN

Primary citation

Same structure, different function crystal structure of the Epstein-Barr virus IL-10 bound to the soluble IL-10R1 chain. Yoon, S.I., Jones, B.C., Logsdon, N.J. et al. Structure (2005) 13:551-564. DOI 10.1016/j.str.2005.01.016 · PubMed

Other PDB entries of the same protein (UniProt P03180 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1VLK 1.9 Å, Structure of viral interleukin-10
1Y6M 2.8 Å, Crystal structure of Epstein-Barr virus IL-10 complexed with the soluble IL-10R1 chain

Browse structure collections

About this viewer

MolViewer shows 1Y6N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.