Crystal structure of Epstein-Barr virus IL-10 complexed with the soluble IL-10R1 chain. Determined by X-ray diffraction at 2.8 Å resolution. Released 3 May 2005.
Explore 1Y6M in 3D Show helices and sheets RCSB PDB PDBe
1Y6M contains 19 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 19-31 | 13 | |
| α-helix | 34-40 | 7 | |
| α-helix | 52-56 | 5 | |
| α-helix | 61-71 | 11 | |
| α-helix | 72-76 | 5 | |
| α-helix | 77-83 | 7 | |
| α-helix | 85-87 | 3 | |
| α-helix | 88-97 | 10 | |
| α-helix | 99-105 | 7 | |
| α-helix | 113-115 | 3 | |
| α-helix | 120-129 | 10 | |
| α-helix | 132-154 | 23 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-8 | 3 | |
| β-strand | 11-14 | 4 | 1 |
| β-strand | 15-16 | 2 | 2 |
| β-strand | 21-24 | 4 | 1 |
| α-helix | 26-27 | 2 | |
| β-strand | 35-41 | 7 | 3 |
| β-strand | 42 | 1 | 4 |
| β-strand | 48-55 | 8 | 3 |
| β-strand | 59-61 | 3 | 1 |
| α-helix | 64-71 | 8 | |
| β-strand | 75 | 1 | 4 |
| β-strand | 78-83 | 6 | 3 |
| β-strand | 86-87 | 2 | 3 |
| α-helix | 88-90 | 3 | |
| β-strand | 91-92 | 2 | 3 |
| β-strand | 97 | 1 | 4 |
| α-helix | 99-101 | 3 | |
| β-strand | 102-103 | 2 | 2 |
| β-strand | 104 | 1 | 5 |
| β-strand | 110-113 | 4 | 6 |
| β-strand | 117-121 | 5 | 6 |
| α-helix | 136-139 | 4 | |
| β-strand | 144-152 | 9 | 7 |
| β-strand | 159-164 | 6 | 7 |
| β-strand | 168-172 | 5 | 6 |
| β-strand | 179-188 | 10 | 7 |
| β-strand | 195 | 1 | 5 |
| α-helix | 197-200 | 4 | |
| β-strand | 201-204 | 4 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Viral interleukin-10 homolog | L | protein | 145 | Human herpesvirus 4 | P03180 (AlphaFold model) |
| Interleukin-10 receptor alpha chain | R | protein | 214 | Homo sapiens | Q13651 (AlphaFold model) |
>1Y6M_1 Viral interleukin-10 homolog (chains L) QCDNFPQMLRDLRDAFSRVKTFFQTKDEVDNLLLKESLLEDFKGYLGCQALSEMIQFYLE EVMPQAENQDPEAKDHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQIKNAFNKLQEK GIYKAMSEFDIFINYIEAYMTIKAR
>1Y6M_2 Interleukin-10 receptor alpha chain (chains R) HGTELPSPPSVWFEAEFFHHILHWTPIPQQSESTCYEVALLRYGIESWNSISQCSQTLSY DLTAVTLDLYHSNGYRARVRAVDGSRHSQWTVTNTRFSVDEVTLTVGSVNLEIHNGFILG KIQLPRPKMAPAQDTYESIFSHFREYEIAIRKVPGQFTFTHKKVKHEQFSLLTSGEVGEF CVQVKPSVASRSNKGMWSKEECISLTRQYFTVTN
Same structure, different function crystal structure of the Epstein-Barr virus IL-10 bound to the soluble IL-10R1 chain. Yoon, S.I., Jones, B.C., Logsdon, N.J. et al. Structure (2005) 13:551-564. DOI 10.1016/j.str.2005.01.016 · PubMed
Other PDB entries of the same protein (UniProt P03180 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1Y6M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.