1VLW: PDB entry 1VLW

Crystal structure of 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase (TM0066) from Thermotoga maritima at 2.30 A resolution. Determined by X-ray diffraction at 2.3 Å resolution. Released 24 Aug 2004.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Thermotoga maritima
Chains: 3
Atoms: 4,770
Mol. weight: 71.19 kDa
Released: 24 Aug 2004

Explore 1VLW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1VLW contains 33 α-helices and 30 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	0-10	11
β-strand	12-16	5	1
α-helix	21-33	13
β-strand	38-42	5	1
α-helix	48-53	6
α-helix	56-59	4
β-strand	64-68	5	1
α-helix	73-82	10
β-strand	87-88	2	1
α-helix	94-102	9
β-strand	107-108	2	1
β-strand	110-111	2	2
α-helix	114-122	9
β-strand	127-130	4	2
α-helix	138-145	8
β-strand	152-155	4	2
β-strand	156	1	1
α-helix	164-169	6
β-strand	175-177	3	1
α-helix	179-182	4
α-helix	186-202	17

Chain B: 11 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	-1-10	12
β-strand	12-16	5	3
α-helix	21-33	13
β-strand	38-42	5	3
α-helix	48-54	7
α-helix	56-59	4
β-strand	64-68	5	3
α-helix	73-82	10
β-strand	86-88	3	3
α-helix	94-103	10
β-strand	106-108	3	3
β-strand	110-111	2	4
α-helix	114-122	9
β-strand	127-130	4	4
α-helix	138-145	8
β-strand	152-155	4	4
β-strand	156	1	3
α-helix	164-170	7
β-strand	175-177	3	3
α-helix	179-182	4
α-helix	186-201	16

Chain C: 11 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	1-10	10
β-strand	12-16	5	5
α-helix	21-33	13
β-strand	38-42	5	5
α-helix	48-54	7
α-helix	56-60	5
β-strand	64-68	5	5
α-helix	73-81	9
β-strand	86-88	3	5
α-helix	94-103	10
β-strand	106-108	3	5
β-strand	110-111	2	6
α-helix	114-122	9
β-strand	127-130	4	6
α-helix	138-145	8
β-strand	152-155	4	6
β-strand	156	1	5
α-helix	164-169	6
β-strand	175-177	3	5
α-helix	179-182	4
α-helix	186-202	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase	A, B, C	protein	217	Thermotoga maritima	Q9WXS1 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>1VLW_1 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase (chains A, B, C)
MGSDKIHHHHHHMKMEELFKKHKIVAVLRANSVEEAKEKALAVFEGGVHLIEITFTVPDA
DTVIKELSFLKEKGAIIGAGTVTSVEQCRKAVESGAEFIVSPHLDEEISQFCKEKGVFYM
PGVMTPTELVKAMKLGHTILKLFPGEVVGPQFVKAMKGPFPNVKFVPTGGVNLDNVCEWF
KAGVLAVGVGSALVKGTPDEVREKAKAFVEKIRGCTE

Primary citation

Crystal structure of 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase (TM0066) from Thermotoga maritima at 2.30 A resolution. Joint Center for Structural Genomics (JCSG). To be published.

Other PDB entries of the same protein (UniProt Q9WXS1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1WA3 1.9 Å, Mechanism of the Class I KDPG aldolase
9UAQ 2.29 Å, CryoEM structure of GFP-like protein from Aequorea coerulescens with Trimbody
9UCL 2.43 Å, CryoEM structure of IgV domain of human Nectin-4 with Trimbody
9XOU 2.5 Å, CryoEM structure of LacY with Trimbody
9UBR 2.62 Å, CryoEM structure of human Galectin-10 with iTrimbody
8SZZ 2.9 Å, CryoEM Structure of Computationally Designed Nanocage O32-ZL4
8TVB 2.9 Å, Ghanaian virus fusion glycoprotein (GhV F)
8TYC 3.3 Å, Lassa GPC (strain Josiah) bound to rabbit polyclonal base-targeting antibody Base-1
8E01 3.4 Å, Structure of engineered nano-cage fusion protein
8JGC 3.44 Å, Cryo-EM structure of Mi3 fused with LOV2
8JGA 3.68 Å, Cryo-EM structure of Mi3 fused with FKBP
7B3Y 3.7 Å, Structure of a nanoparticle for a COVID-19 vaccine candidate

Browse structure collections

About this viewer

MolViewer shows 1VLW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.