8JGC: Mi3 fused with LOV2

Cryo-EM structure of Mi3 fused with LOV2. Determined by electron microscopy at 3.44 Å resolution. Released 24 Apr 2024.

Method: Electron microscopy
Resolution: 3.44 Å
Organisms: Aegilops tauschii subsp. strangulata, Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Chains: 1
Atoms: 1,516
Mol. weight: 41.42 kDa
Released: 24 Apr 2024

Explore 8JGC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8JGC contains 7 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	3-10	8
β-strand	14	1	1
β-strand	15-16	2	2
α-helix	23-34	12
β-strand	38-42	5	2
α-helix	48-61	14
β-strand	64-68	5	2
α-helix	73-81	9
β-strand	86-88	3	3
α-helix	94-103	10
β-strand	106-108	3	3
β-strand	110	1	4
α-helix	114-121	8
β-strand	129	1	4
β-strand	153	1	5
β-strand	172	1	5
β-strand	177	1	1
α-helix	186-202	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
LOV domain-containing protein,2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate…	A	protein	378	Aegilops tauschii subsp. strangulata, Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)	Q9WXS1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8JGC_1 LOV domain-containing protein,2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase (chains A)
MGSSEFLATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNCRFLQGPE
TDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNVFHLQPMRDYKGDVQYFIGVQLDGT
ERLHGAAEREAVCLIKKTAFQIAEAANDENYFGGSGGSGGSGGSMKMEELFKKHKIVAVL
RANSVEEAKKKALAVFLGGVHLIEITFTVPDADTVIKELSFLKEMGAIIGAGTVTSVEQA
RKAVESGAEFIVSPHLDEEISQFAKEKGVFYMPGVMTPTELVKAMKLGHTILKLFPGEVV
GPQFVKAMKGPFPNVKFVPTGGVNLDNVCEWFKAGVLAVGVGSALVKGTPVEVAEKAKAF
VEKIRGCTEGSGHHHHHH

Primary citation

Dynamic Metabolons Using Stimuli-Responsive Protein Cages. Kang, W., Ma, X., Zhang, H. et al. J Am Chem Soc (2024) 146:6686-6696. DOI 10.1021/jacs.3c12876 · PubMed

Other PDB entries of the same protein (UniProt Q9WXS1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1WA3 1.9 Å, Mechanism of the Class I KDPG aldolase
9UAQ 2.29 Å, CryoEM structure of GFP-like protein from Aequorea coerulescens with Trimbody
1VLW 2.3 Å, Crystal structure of 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate…
9UCL 2.43 Å, CryoEM structure of IgV domain of human Nectin-4 with Trimbody
9XOU 2.5 Å, CryoEM structure of LacY with Trimbody
9UBR 2.62 Å, CryoEM structure of human Galectin-10 with iTrimbody
8SZZ 2.9 Å, CryoEM Structure of Computationally Designed Nanocage O32-ZL4
8TVB 2.9 Å, Ghanaian virus fusion glycoprotein (GhV F)
8TYC 3.3 Å, Lassa GPC (strain Josiah) bound to rabbit polyclonal base-targeting antibody Base-1
8E01 3.4 Å, Structure of engineered nano-cage fusion protein
8JGA 3.68 Å, Cryo-EM structure of Mi3 fused with FKBP
7B3Y 3.7 Å, Structure of a nanoparticle for a COVID-19 vaccine candidate

Browse structure collections

About this viewer

MolViewer shows 8JGC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.