Solution Structure of the C-terminal RING from a RING-IBR-RING (TRIAD) motif. Determined by solution NMR. Released 20 Jul 2004.
Explore 1WD2 in 3D Show helices and sheets RCSB PDB PDBe
1WD2 contains 2 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 41-43 | 3 | |
| α-helix | 55-58 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ariadne-1 protein homolog | A | protein | 60 | Homo sapiens | Q9Y4X5 (AlphaFold model) |
>1WD2_1 Ariadne-1 protein homolog (chains A) WIAANTKECPKCHVTIEKDGGCNHMVCRNQNCKAEFCWVCLGPWEPHGSAWYNCNRYNEF
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 1 |
Structure of the C-terminal RING Finger from a RING-IBR-RING/TRIAD Motif Reveals a Novel Zinc-binding Domain Distinct from a RING. Capili, A.D., Edghill, E.L., Wu, K. et al. J Mol Biol (2004) 340:1117-1129. DOI 10.1016/j.jmb.2004.05.035 · PubMed
Other PDB entries of the same protein (UniProt Q9Y4X5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1WD2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.