Structure of HHARI, a RING-IBR-RING ubiquitin ligase: autoinhibition of an Ariadne-family E3 and insights into ligation mechanism. Determined by X-ray diffraction at 3.3 Å resolution. Released 29 May 2013.
Explore 4KBL in 3D Show helices and sheets RCSB PDB PDBe
4KBL contains 32 α-helices and 30 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 101-104 | 4 | 1 |
| α-helix | 106-119 | 14 | |
| α-helix | 128-137 | 10 | |
| α-helix | 142-151 | 10 | |
| β-strand | 200 | 1 | 2 |
| β-strand | 206 | 1 | 2 |
| α-helix | 209-219 | 11 | |
| β-strand | 230 | 1 | 3 |
| α-helix | 238 | 1 | |
| β-strand | 239 | 1 | 3 |
| α-helix | 240-241 | 2 | |
| α-helix | 242-248 | 7 | |
| α-helix | 254-269 | 16 | |
| β-strand | 273-275 | 3 | 1 |
| β-strand | 284-287 | 4 | 1 |
| β-strand | 294-296 | 3 | 4 |
| β-strand | 302-304 | 3 | 4 |
| α-helix | 317-326 | 10 | |
| β-strand | 341-343 | 3 | 5 |
| β-strand | 350-352 | 3 | 5 |
| β-strand | 359-361 | 3 | 6 |
| β-strand | 370-372 | 3 | 6 |
| β-strand | 378 | 1 | 6 |
| α-helix | 409-432 | 24 | |
| α-helix | 434-440 | 7 | |
| α-helix | 458-480 | 23 | |
| α-helix | 482-484 | 3 | |
| α-helix | 486-507 | 22 | |
| α-helix | 508-512 | 5 | |
| α-helix | 521-549 | 29 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 101-104 | 4 | 7 |
| α-helix | 106-120 | 15 | |
| α-helix | 128-138 | 11 | |
| α-helix | 142-151 | 10 | |
| α-helix | 195-197 | 3 | |
| β-strand | 200 | 1 | 8 |
| β-strand | 206 | 1 | 8 |
| α-helix | 209-220 | 12 | |
| β-strand | 230 | 1 | 9 |
| β-strand | 239 | 1 | 9 |
| α-helix | 244-247 | 4 | |
| α-helix | 254-269 | 16 | |
| β-strand | 273-275 | 3 | 7 |
| β-strand | 284-287 | 4 | 7 |
| β-strand | 294-296 | 3 | 10 |
| β-strand | 302-304 | 3 | 10 |
| α-helix | 317-323 | 7 | |
| β-strand | 341-343 | 3 | 11 |
| β-strand | 350-352 | 3 | 11 |
| β-strand | 359-361 | 3 | 12 |
| β-strand | 370-372 | 3 | 12 |
| β-strand | 378 | 1 | 12 |
| β-strand | 384 | 1 | 13 |
| β-strand | 387 | 1 | 13 |
| α-helix | 409-432 | 24 | |
| α-helix | 434-441 | 8 | |
| α-helix | 457-477 | 21 | |
| α-helix | 482-484 | 3 | |
| α-helix | 486-507 | 22 | |
| α-helix | 508-512 | 5 | |
| α-helix | 513-515 | 3 | |
| α-helix | 521-548 | 28 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| E3 ubiquitin-protein ligase ARIH1 | A, B | protein | 559 | Homo sapiens | Q9Y4X5 (AlphaFold model) |
>4KBL_1 E3 ubiquitin-protein ligase ARIH1 (chains A, B) GSMDSDEGYNYEFDEDEECSEEDSGAEEEEDEDDDEPDDDTLDLGEVELVEPGLGVGGER DGLLCGETGGGGGSALGPGGGGGGGGGGGGGGPGHEQEEDYRYEVLTAEQILQHMVECIR EVNEVIQNPATITRILLSHFNWDKEKLMERYFDGNLEKLFAECHVINPSKKSRTRQMNTR SSAQDMPCQICYLNYPNSYFTGLECGHKFCMQCWSEYLTTKIMEEGMGQTISCPAHGCDI LVDDNTVMRLITDSKVKLKYQHLITNSFVECNRLLKWCPAPDCHHVVKVQYPDAKPVRCK CGRQFCFNCGENWHDPVKCKWLKKWIKKCDDDSETSNWIAANTKECPKCHVTIEKDGGCN HMVCRNQNCKAEFCWVCLGPWEPHGSAWYNCNRYNEDDAKAARDAQERSRAALQRYLFYC NRYMNHMQSLRFEHKLYAQVKQKMEEMQQHNMSWIEVQFLKKAVDVLCQCRATLMYTYVF AFYLKKNNQSIIFENNQADLENATEVLSGYLERDISQDSLQDIKQKVQDKYRYCESRRRV LLQHVHEGYEKDLWEYIED
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 12 |
Structure of HHARI, a RING-IBR-RING Ubiquitin Ligase: Autoinhibition of an Ariadne-Family E3 and Insights into Ligation Mechanism. Duda, D.M., Olszewski, J.L., Schuermann, J.P. et al. Structure (2013) 21:1030-1041. DOI 10.1016/j.str.2013.04.019 · PubMed
Other PDB entries of the same protein (UniProt Q9Y4X5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4KBL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.