4KC9: E3 ubiquitin-protein ligase ARIH1

Name: PDB 4KC9: Structure of HHARI, a RING-IBR-RING ubiquitin ligase: autoinhibition of an Ariadne-family E3 and insights into ligation mechanism
Published: 2013-05-29
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ligase

Structure of HHARI, a RING-IBR-RING ubiquitin ligase: autoinhibition of an Ariadne-family E3 and insights into ligation mechanism. Determined by X-ray diffraction at 3.6 Å resolution. Released 29 May 2013.

Method: X-ray diffraction
Resolution: 3.6 Å
Organism: Homo sapiens
Chains: 1
Atoms: 3,139
Mol. weight: 65.48 kDa
Ligands: ZN
Released: 29 May 2013

Explore 4KC9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4KC9 contains 18 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	102-104	3	1
α-helix	106-119	14
α-helix	121-124	4
α-helix	128-137	10
α-helix	143-150	8
α-helix	154-161	8
α-helix	195-197	3
β-strand	198-200	3	2
β-strand	206-208	3	2
α-helix	209-221	13
α-helix	239-241	3
α-helix	242-248	7
α-helix	252-268	17
β-strand	273-275	3	1
β-strand	284-286	3	1
β-strand	294-296	3	3
β-strand	302-304	3	3
β-strand	310	1	3
α-helix	317-326	10
β-strand	341-343	3	4
β-strand	350-352	3	4
β-strand	359-361	3	5
β-strand	370-372	3	5
β-strand	378	1	5
β-strand	382	1	6
β-strand	384	1	6
α-helix	409-429	21
α-helix	434-448	15
α-helix	452-455	4
α-helix	457-481	25
α-helix	488-506	19
α-helix	508-512	5
α-helix	518-546	29

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase ARIH1	A	protein	559	Homo sapiens	Q9Y4X5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4KC9_1 E3 ubiquitin-protein ligase ARIH1 (chains A)
GSMDSDEGYNYEFDEDEECSEEDSGAEEEEDEDDDEPDDDTLDLGEVELVEPGLGVGGER
DGLLCGETGGGGGSALGPGGGGGGGGGGGGGGPGHEQEEDYRYEVLTAEQILQHMVECIR
EVNEVIQNPATITRILLSHFNWDKEKLMERYFDGNLEKLFAECHVINPSKKSRTRQMNTR
SSAQDMPCQICYLNYPNSYFTGLECGHKFCMQCWSEYLTTKIMEEGMGQTISCPAHGCDI
LVDDNTVMRLITDSKVKLKYQHLITNSFVECNRLLKWCPAPDCHHVVKVQYPDAKPVRCK
CGRQFCFNCGENWHDPVKCKWLKKWIKKCDDDSETSNWIAANTKECPKCHVTIEKDGGCN
HMVCRNQNCKAEFCWVCLGPWEPHGSAWYNCNRYNEDDAKAARDAQERSRAALQRYLFYC
NRYMNHMQSLRFEHKLYAQVKQKMEEMQQHNMSWIEVQFLKKAVDVLCQCRATLMYTYVF
AFYLKKNNQSIIFENNQADLENATEVLSGYLERDISQDSLQDIKQKVQDKYRYCESRRRV
LLQHVHEGYEKDLWEYIED

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	6

Primary citation

Structure of HHARI, a RING-IBR-RING Ubiquitin Ligase: Autoinhibition of an Ariadne-Family E3 and Insights into Ligation Mechanism. Duda, D.M., Olszewski, J.L., Schuermann, J.P. et al. Structure (2013) 21:1030-1041. DOI 10.1016/j.str.2013.04.019 · PubMed

Other PDB entries of the same protein (UniProt Q9Y4X5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5UDH 3.24 Å, HHARI/ARIH1-UBCH7~Ubiquitin
4KBL 3.3 Å, Structure of HHARI, a RING-IBR-RING ubiquitin ligase: autoinhibition of an…
5TTE 3.5 Å, Crystal Structure of an RBR E3 ubiquitin ligase in complex with an E2-Ub thioester…
7B5N 3.6 Å, Ubiquitin ligation to F-box protein substrates by SCF-RBR E3-E3 super-assembly:…
7B5S 3.6 Å, Ubiquitin ligation to F-box protein substrates by SCF-RBR E3-E3 super-assembly:…
7B5L 3.8 Å, Ubiquitin ligation to F-box protein substrates by SCF-RBR E3-E3 super-assembly:…
7B5M 3.91 Å, Ubiquitin ligation to F-box protein substrates by SCF-RBR E3-E3 super-assembly:…
1WD2 Solution Structure of the C-terminal RING from a RING-IBR-RING (TRIAD) motif
2M9Y Solution Structure of the Catalytic Domain of HHARI

Browse structure collections

About this viewer

MolViewer shows 4KC9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.