1WDZ: RCB domain of IRSp53

Crystal structure of RCB domain of IRSp53. Determined by X-ray diffraction at 2.63 Å resolution. Released 7 Jun 2005.

Method: X-ray diffraction
Resolution: 2.63 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,712
Mol. weight: 55.19 kDa
Released: 7 Jun 2005

Explore 1WDZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1WDZ contains 17 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	4-19	16
α-helix	20-24	5
α-helix	25-64	40
α-helix	70-96	27
α-helix	97-102	6
α-helix	103-110	8
α-helix	112-145	34
α-helix	150-152	3
α-helix	155-231	77

Chain B: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	6-19	14
α-helix	20-24	5
α-helix	25-65	41
α-helix	70-97	28
α-helix	98-102	5
α-helix	103-109	7
α-helix	112-145	34
α-helix	162-231	70

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
insulin receptor substrate p53	A, B	protein	242	Homo sapiens	Q9UQB8 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1WDZ_1 insulin receptor substrate p53 (chains A, B)
GSTMSLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALV
KMGELASESQGSKELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLS
AALKKYQTEQRSKGDALDKCQAELKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELEN
YVSDGYKTALTEERRRFCFLVEKQCAVAKNSAAYHSKGKELLAQKLPLWQQGVDSSGRIV
TD

Primary citation

Crystal structure of RCB domain of IRSp53. Murayama, K., Suetsugu, S., Seto, A. et al. To be published.

Other PDB entries of the same protein (UniProt Q9UQB8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6ZEG 1.09 Å, Structure of PP1-IRSp53 chimera [PP1(7-304) + linker (G/S)x9 + IRSp53(449-465)] bound to…
6ZEI 1.39 Å, Structure of PP1-IRSp53 S455E chimera [PP1(7-304) + linker (G/S)x9 + IRSp53(449-465)]…
3RNJ 1.5 Å, Crystal structure of the SH3 domain from IRSp53 (BAIAP2)
4JS0 1.9 Å, Complex of Cdc42 with the CRIB-PR domain of IRSp53
6BCR 1.99 Å, Complex of 14-3-3 theta with an IRSp53 peptide phosphorylated at T340
2YKT 2.11 Å, Crystal structure of the I-BAR domain of IRSp53 (BAIAP2) in complex with an EHEC derived…
1Y2O 2.2 Å, Structure of N-terminal domain IRSp53/BAIAP2
6BCY 2.3 Å, Complex of 14-3-3 theta with an IRSp53 peptide phosphorylated at T360
6BD1 2.35 Å, Complex of 14-3-3 theta with an IRSp53 peptide phosphorylated at S366
6BQT 2.8 Å, Complex of 14-3-3 theta with an IRSp53 peptide doubly-phosphorylated at T340 and T360
6BD2 2.9 Å, Complex of 14-3-3 theta with an IRSp53 peptide doubly-phosphorylated at T340 and S366

Browse structure collections

About this viewer

MolViewer shows 1WDZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.