1WG0: Probable 26S proteasome regulatory subunit p28

Structural comparison of Nas6p protein structures in two different crystal forms. Determined by X-ray diffraction at 2.53 Å resolution. Released 7 Jun 2005.

Method: X-ray diffraction
Resolution: 2.53 Å
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 2,114
Mol. weight: 27.39 kDa
Released: 7 Jun 2005

Explore 1WG0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1WG0 contains 16 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	5-12	8
α-helix	15-24	10
α-helix	26-30	5
α-helix	39-45	7
α-helix	49-58	10
α-helix	64-66	3
α-helix	75-82	8
α-helix	85-92	8
α-helix	110-116	7
α-helix	120-128	9
α-helix	143-149	7
α-helix	153-160	8
α-helix	177-183	7
α-helix	187-197	11
β-strand	204	1	1
β-strand	210	1	1
α-helix	211-214	4
α-helix	218-225	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Probable 26S proteasome regulatory subunit p28	A	protein	243	Saccharomyces cerevisiae	P50086 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1WG0_1 Probable 26S proteasome regulatory subunit p28 (chains A)
MSNYPLHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKME
NVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWF
EVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFH
ALAEGHGDAAVLLVEKYGAEYDLVDNKGAKAEDVALNEQVKKFFLNNVVDKLAAALEHHH
HHH

Primary citation

Structural comparison of Nas6p protein structures in two different crystal forms. Nakamura, Y., Umehara, T., Tanaka, A. et al. To be published.

Other PDB entries of the same protein (UniProt P50086 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2DZN 2.2 Å, Crystal structure analysis of yeast Nas6p complexed with the proteasome subunit, rpt3
1IXV 2.3 Å, Crystal Structure Analysis of homolog of oncoprotein gankyrin, an interactor of Rb and…
2DZO 3.0 Å, Crystal structure analysis of yeast Nas6p complexed with the proteasome subunit, rpt3
35ZW 3.31 Å, yeast 26S proteasome base assembly intermediate, Hsm3-Rpt1-Rpt2-Rpt3-Rpt4-Rpt5…
36BM 3.82 Å, yeast 26S proteasome base assembly intermediate, base-Hsm3-Nas6 with Rpt4-EQ
36BL 3.91 Å, yeast 26S proteasome base assembly intermediate, base-Rpn14-Hsm3-Nas6(2) with Rpt4-EQ
36BD 3.93 Å, yeast 26S proteasome base assembly intermediate, base-Rpn14-Hsm3-Nas6 with Rpt4-EQ
36AX 4.87 Å, yeast 26S proteasome base assembly intermediate, base-Nas2-Rpn14-Hsm3-Nas6 with Rpt4-EQ

Browse structure collections

About this viewer

MolViewer shows 1WG0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.