1WG5: Heterogeneous nuclear ribonucleoprotein H

Solution structure of the first RRM domain in heterogeneous nuclear ribonucleoprotein H. Determined by solution NMR. Released 27 Nov 2004.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 789
Mol. weight: 11.22 kDa
Released: 27 Nov 2004

Explore 1WG5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1WG5 contains 3 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	17-21	5	1
α-helix	23-24	2
α-helix	29-35	7
β-strand	41-47	7	1
β-strand	50	1	2
β-strand	56	1	2
β-strand	59-64	6	1
α-helix	67-74	8
β-strand	87-91	5	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Heterogeneous nuclear ribonucleoprotein H	A	protein	104	Homo sapiens	P55795 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1WG5_1 Heterogeneous nuclear ribonucleoprotein H (chains A)
GSSGSSGNSPDTANDGFVRLRGLPFGCSKEEIVQFFSGLEIVPNGMTLPVDFQGRSTGEA
FVQFASQEIAEKALKKHKERIGHRYIEIFKSSRAEVRTSGPSSG

Primary citation

Solution structure of the first RRM domain in heterogeneous nuclear ribonucleoprotein H. He, F., Muto, Y., Inoue, M. et al. To be published.

Other PDB entries of the same protein (UniProt P55795 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8SGH 3.17 Å, Cryo-EM structure of Karyopherin-beta2 bound to HNRNPH2 PY-NLS
1WEZ Solution structure of RRM domain in heterogeneous nuclear ribonucleoprotein H'
6DG1 NMR structure of the second qRRM2 domain of human hnRNP H

Browse structure collections

About this viewer

MolViewer shows 1WG5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.