1WGN: Ubiquitin associated protein

Solution Structure of UBA domain of Human Ubiquitin Associated Protein 1 (UBAP1). Determined by solution NMR. Released 28 Nov 2004.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 473
Mol. weight: 6.81 kDa
Released: 28 Nov 2004

Explore 1WGN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1WGN contains 4 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	10-13	4
α-helix	17-30	14
α-helix	33-43	11
α-helix	47-57	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ubiquitin associated protein	A	protein	63	Homo sapiens	Q9NZ09 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1WGN_1 ubiquitin associated protein (chains A)
GSSGSSGAYSELQMLSPSERQCVETVVNMGYSYECVLRAMKKKGENIEQILDYLFAHSGP
SSG

Primary citation

Solution Structure of UBA domain of Human Ubiquitin Associated Protein 1 (UBAP1). Zhao, C., Tomizawa, T., Koshiba, S. et al. To be published.

Other PDB entries of the same protein (UniProt Q9NZ09 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4AE4 1.65 Å, The UBAP1 subunit of ESCRT-I interacts with ubiquitin via a novel SOUBA domain
5LM1 2.55 Å, Crystal Structure of HD-PTP phosphatase in complex with UBAP1

Browse structure collections

About this viewer

MolViewer shows 1WGN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.